RegenerativeMedicine.net

A potential wound-healing-promoting peptide from salamander skin

Authors: Lixian Mu, Jing Tang, Han Liu, Chuanbin Shen, Mingqiang Rong, Zhiye Zhang, and Ren Lai

Summary:

Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.

Source: The FASEB Journal; Vol. 28, No. 9, 3919-3929 (09/2014)

Newsletter Archives


U.S. News
World News
Regenerative Medicine Journal
Point Of View

Regenerative Medicine Journal

Editorial: Exploring the frontiers of regenerative cardiovascular medicine Partial recovery of visual function in a blind patient after optogenetic therapy Microfluidics for understanding model organisms Freeform 3d ice printing (3D-ICE) at the micro scale Behavioral and inflammatory sex differences revealed by celecoxib nanotherapeutic treatment of peripheral neuroinflammation Profiling of mature-stage human breast milk cells identifies six unique lactocyte subpopulations Mathematical modeling finds disparate interferon production rates drive strain-specific immunodynamics during deadly influenza infection Exploration of race and ethnicity, sex, sport-related concussion, depression history, and suicide attempts in US youth Solutal-buoyancy-driven intertwining and rotation of patterned elastic sheets Assessing the global burden of hemorrhage: The global blood supply, deficits, and potential solutions Fasting induces a highly resilient deep quiescent state in muscle stem cells via ketone body signaling In vivo engraftment into the cornea endothelium using extracellular matrix shrink-wrapped cells First detection of SARS-CoV-2 Omicron BA.4 variant in Western Pennsylvania, United States Self-regulated non-reciprocal motions in single-material microstructures Utility of biomarkers for sepsis-associated acute kidney injury staging Putting the theory into 'burstlet theory' with a biophysical model of burstlets and bursts in the respiratory preBötzinger complex Sensing and decoding the neural drive to paralyzed muscles during attempted movements of a person with tetraplegia using a sleeve array Recapitulating human cardio-pulmonary co-development using simultaneous multilineage differentiation of pluripotent stem cells Outcome prediction in patients with severe traumatic brain injury using deep learning from head CT scans ESR1 mutant breast cancers show elevated basal cytokeratins and immune activation Hotspot ESR1 mutations are multimodal and contextual modulators of breast cancer metastasis LAG3 associates with TCR–CD3 complexes and suppresses signaling by driving co-receptor–Lck dissociation Hepatocyte nuclear factor 4 alpha 2 messenger RNA reprograms liver-enriched transcription factors and functional proteins in end-stage cirrhotic human hepatocytes Engineering pro-angiogenic biomaterials via chemoselective extracellular vesicle immobilization Uncompensated mitochondrial oxidative stress underlies heart failure in an iPSC-derived model of congenital heart disease Motor neuroprosthesis implanted with neurointerventional surgery improves capacity for activities of daily living tasks in severe paralysis: first in-human experience A synthetic gene library yields a previously unknown glycoside phosphorylase that degrades and assembles Poly-β-1,3-GlcNAc, completing the suite of β-linked GlcNAc polysaccharides Thin and stretchable extracellular matrix (ECM) membrane reinforced by nanofiber scaffolds for developing in vitro barrier models Specific mesoderm subset derived from human pluripotent stem cells ameliorates microvascular pathology in type 2 diabetic mice Bioinstructive implantable scaffolds for rapid in vivo manufacture and release of CAR-T cells Harmonic acoustics for dynamic and selective particle manipulation High-speed light-sheet microscopy for the in-situ acquisition of volumetric histological images of living tissue Coagulation factor protein abundance in the pre-septic state predicts coagulopathic activities that arise during late-stage murine sepsis Cx43 hemichannels contribute to astrocyte-mediated toxicity in sporadic and familial ALS TRPM2 deficiency in mice protects against atherosclerosis by inhibiting TRPM2–CD36 inflammatory axis in macrophages Persistent post-concussive syndrome in children after mild traumatic brain injury is prevalent and vastly underdiagnosed Targeting ON-bipolar cells by AAV gene therapy stably reverses LRIT3 -congenital stationary night blindness A simple method to generate human airway epithelial organoids with externally orientated apical membranes Spatial charting of single-cell transcriptomes in tissues Patient-specific magnetic catheters for atraumatic autonomous endoscopy Ketogenic diet and chemotherapy combine to disrupt pancreatic cancer metabolism and growth GIT1 protects against breast cancer growth through negative regulation of Notch A non-dividing cell population with high pyruvate dehydrogenase kinase activity regulates metabolic heterogeneity and tumorigenesis in the intestine A NanoBiT assay to monitor membrane proteins trafficking for drug discovery and drug development Deep learning‐assisted automated single cell electroporation platform for effective genetic manipulation of hard‐to‐transfect cells Genome-wide association studies identify novel genetic loci for epigenetic age acceleration among survivors of childhood cancer Dextran-mimetic quantum dots for multimodal macrophage imaging in vivo, ex vivo, and in situ Scalable thousand channel penetrating microneedle arrays on flex for multimodal and large area coverage brain machine interfaces Single-molecule Taq DNA polymerase dynamics Engineered extracellular vesicles antagonize SARS-CoV-2 infection by inhibiting mTOR signaling Autophagy–mediated plasma membrane removal promotes the formation of epithelial syncytia Repeated intravenous cardiosphere-derived cell therapy in late-stage Duchenne muscular dystrophy (HOPE-2): a multicentre, randomised, double-blind, placebo-controlled, phase 2 trial Nanoparticles surface chemistry influence on protein corona composition and inflammatory responses Correlation between leukocyte phenotypes and prognosis of amyotrophic lateral sclerosis Pericyte-to-endothelial cell signaling via vitronectin-integrin regulates blood-CNS barrier Müller glia fused with adult stem cells undergo neural differentiation in human retinal models Ectopic lymphoid follicle formation and human seasonal influenza vaccination responses recapitulated in an organ‐on‐a‐chip Bayesian nonparametric inference for heterogeneously mixing infectious disease models Age-associated decline of MondoA drives cellular senescence through impaired autophagy and mitochondrial homeostasis Epicardial slices: an innovative 3D organotypic model to study epicardial cell physiology and activation A single factor elicits multilineage reprogramming of astrocytes in the adult mouse striatum Confined migration promotes cancer metastasis through resistance to anoikis and increased invasiveness Co-targeting of BAX and BCL-XL proteins broadly overcomes resistance to apoptosis in cancer DNA replication fork speed underlies cell fate changes and promotes reprogramming Mechanistic impact of oligomer poisoning by dominant-negative CARD11 variants Digitally generated Trail Making Test data: Analysis using hidden Markov modeling In vivo partial reprogramming alters age-associated molecular changes during physiological aging in mice Association of acute respiratory failure in early childhood with long-term neurocognitive outcomes BEND3 safeguards pluripotency by repressing differentiation-associated genes Intrinsic sources and functional impacts of asymmetry at electrical synapses Generation of a tendon-like tissue from human iPS cells Small Cajal body-associated RNA 2 (scaRNA2) regulates DNA repair pathway choice by inhibiting DNA-PK Longitudinal single-cell RNA-seq analysis reveals stress-promoted chemoresistance in metastatic ovarian cancer Intermittent ERK oscillations downstream of FGF in mouse embryonic stem cells De novo design of a membrane‐anchored probe for multidimensional quantification of endocytic dynamics Kurarinone alleviated Parkinson's disease via stabilization of epoxyeicosatrienoic acids in animal model Osteoblast-derived vesicles induce a switch from bone-formation to bone-resorption in vivo The bacterial toxin colibactin triggers prophage induction Integrated-omics approach reveals persistent DNA damage rewires lipid metabolism and histone hyperacetylation via MYS-1/Tip60 Personalized chordoma organoids for drug discovery studies Self-healing ionic gelatin/glycerol hydrogels for strain sensing applications Heterometallic benzenehexathiolato coordination nanosheets: periodic structure improves crystallinity and electrical conductivity Emergence of a geometric pattern of cell fates from tissue-scale mechanics in the Drosophila eye Targeted activation of midbrain neurons restores locomotor function in mouse models of parkinsonism Structures from intact myofibrils reveal mechanism of thin filament regulation through nebulin Imaging of innate immunity activation in vivo with a redox-tuned PET reporter Organic electrochemical neurons and synapses with ion mediated spiking Short‐duration high frequency megahertz‐order nanomechanostimulation drives early and persistent osteogenic differentiation in mesenchymal stem cells 3D microvascularized tissue models by laser‐based cavitation molding of collagen Activity-dependent spinal cord neuromodulation rapidly restores trunk and leg motor functions after complete paralysis Rear traction forces drive adherent tissue migration in vivo Associations between retinal nerve fiber layer and ganglion cell layer in middle age and cognition from childhood to adulthood A gut-derived metabolite alters brain activity and anxiety behaviour in mice The spatial transcriptomic landscape of the healing mouse intestine following damage CFTR interactome mapping using the mammalian membrane two-hybrid high-throughput screening system Loss of TREM2 rescues hyperactivation of microglia, but not lysosomal deficits and neurotoxicity in models of progranulin deficiency Randomised phase II trial of weekly ixabepilone ± biweekly bevacizumab for platinum-resistant or refractory ovarian/fallopian tube/primary peritoneal cancer Myocardial injury pattern at MRI in COVID-19 vaccine–associated myocarditis An autonomously swimming biohybrid fish designed with human cardiac biophysics Genetic resiliency associated with dominant lethal TPM1 mutation causing atrial septal defect with high heritability Epigenetic basis of oncogenic-Kras-mediated epithelial-cellular proliferation and plasticity Zac1 and the Imprinted Gene Network program juvenile NAFLD in response to maternal metabolic syndrome A hyperpromiscuous antitoxin protein domain for the neutralization of diverse toxin domains Sleep health composites are associated with the risk of heart disease across sex and race In vivo mitochondrial base editing via adeno-associated viral delivery to mouse post-mitotic tissue The solute carrier MFSD1 decreases the activation status of β1 integrin and thus tumor metastasis GSDMB is increased in IBD and regulates epithelial restitution/repair independent of pyroptosis A macrophage-hepatocyte glucocorticoid receptor axis coordinates fasting ketogenesis Bidirectional changes in myocardial 18 F-Fluorodeoxyglucose uptake after human ventricular unloading Anthrax toxins regulate pain signaling and can deliver molecular cargoes into ANTXR2+ DRG sensory neurons Mapping transcriptomic vector fields of single cells Acute multidrug delivery via a wearable bioreactor facilitates long-term limb regeneration and functional recovery in adult Xenopus laevis Inhibition of ceramide accumulation in AdipoR1-/- mice increases photoreceptor survival and improves vision The Blood Proteoform Atlas: A reference map of proteoforms in human hematopoietic cells Microskeletal stiffness promotes aortic aneurysm by sustaining pathological vascular smooth muscle cell mechanosensation via Piezo1 Group 3 innate lymphoid cells produce the growth factor HB-EGF to protect the intestine from TNF-mediated inflammation Structural basis for safe and efficient energy conversion in a respiratory supercomplex Oral mRNA delivery using capsule-mediated gastrointestinal tissue injections The acetyltransferase KAT7 is required for thymic epithelial cell expansion, expression of AIRE target genes, and thymic tolerance GLP1R attenuates sympathetic response to high glucose via carotid body inhibition Generation of the organotypic kidney structure by integrating pluripotent stem cell-derived renal stroma Mapping the acute time course of immune cell infiltration into an ECM hydrogel in a rat model of stroke using 19F MRI Mapping molecular subtype specific alterations in breast cancer brain metastases identifies clinically relevant vulnerabilities Randomized trial of closed-loop control in very young children with Type 1 diabetes Assessing kinetics and recruitment of DNA repair factors using high content screens Circulating ACE2-expressing extracellular vesicles block broad strains of SARS-CoV-2 Modeling reduced contractility and impaired desmosome assembly due to plakophilin-2 deficiency using isogenic iPS cell-derived cardiomyocytes An explainable artificial intelligence approach for predicting cardiovascular outcomes using electronic health records SARS-CoV-2 vaccination induces immunological T cell memory able to cross-recognize variants from Alpha to Omicron Bone-specific enhancement of antibody therapy for breast cancer metastasis to bone Harmony COVID-19: A ready-to-use kit, low-cost detector, and smartphone app for point-of-care SARS-CoV-2 RNA detection Serological markers of SARS-CoV-2 reinfection Disease consequences of higher adiposity uncoupled from its adverse metabolic effects using Mendelian randomization Fat-associated lymphoid clusters as expandable niches for ectopic liver development miRNA changes in the mouse placenta due to bisphenol A exposure Multi-ancestry fine mapping implicates OAS1 splicing in risk of severe COVID-19 Longitudinal analysis reveals high prevalence of Epstein-Barr virus associated with multiple sclerosis Dynamics of skeletal muscle-resident stem cells during myogenesis in fibrodysplasia ossificans progressiva CARMN is an evolutionarily conserved smooth muscle cell–specific LncRNA that maintains contractile phenotype by binding myocardin A case-based interpretable deep learning model for classification of mass lesions in digital mammography Strategies to minimize heterogeneity and optimize clinical trials in Acute Respiratory Distress Syndrome (ARDS): Insights from mathematical modelling Genetically engineered and enucleated human mesenchymal stromal cells for the targeted delivery of therapeutics to diseased tissue Subcutaneous nanotherapy repurposes the immunosuppressive mechanism of rapamycin to enhance allogeneic islet graft viability Late‐life physical activity relates to brain tissue synaptic integrity markers in older adults Fixational eye movements following concussion Multiple acyl-CoA dehydrogenase deficiency kills Mycobacterium tuberculosis in vitro and during infection Electrophoretic deposition of collagen/chitosan films with copper-doped phosphate glasses for orthopaedic implants Three-dimensional transistor arrays for intra- and inter-cellular recording Omicron extensively but incompletely escapes Pfizer BNT162b2 neutralization Supramolecular arrangement of protein in nanoparticle structures predicts nanoparticle tropism for neutrophils in acute lung inflammation Engineering CAR-T cells to activate small-molecule drugs in situ Structural and functional diversity among agonist-bound states of the GLP-1 receptor Activation mechanism of PINK1 Neuronal ROS-induced glial lipid droplet formation is altered by loss of Alzheimer’s disease–associated genes The structure of the native CNGA1/CNGB1 CNG channel from bovine retinal rods Biomanufacturing in low Earth orbit for regenerative medicine Exercise plasma boosts memory and dampens brain inflammation via clusterin Multi-omic analysis in injured humans: Patterns align with outcomes and treatment responses 3D virtual histopathology of cardiac tissue from COVID-19 patients based on phase-contrast X-ray tomography Stress ball morphogenesis: How the lizard builds its lung Extracellular hyaluronate pressure shaped by cellular tethers drives tissue morphogenesis Estimating the strength of selection for new SARS-CoV-2 variants SARS-CoV-2 spreads through cell-to-cell transmission Brain transcriptomes of zebrafish and mouse Alzheimer's disease knock-in models imply early disrupted energy metabolism Upregulation of DNA repair genes and cell extrusion underpin the remarkable radiation resistance of Trichoplax adhaerens Inhalant cannabidiol inhibits glioblastoma progression through regulation of tumor microenvironment Fibrin is a critical regulator of neutrophil effector function at the oral mucosal barrier Ultrafast energy transfer between π-stacked aromatic rings upon inner-valence ionization A combined genome-wide association and molecular study of age-related hearing loss in H. sapiens Noninvasive disconnection of targeted neuronal circuitry sparing axons of passage and nonneuronal cells A suspended layer additive manufacturing approach to the bioprinting of tri-layered skin equivalents A particulate saponin/TLR agonist vaccine adjuvant alters lymph flow and modulates adaptive immunity Improved outcome in children with newly diagnosed high-risk neuroblastoma treated with chemoimmunotherapy: updated results of a phase ii study using hu14.18K322A Exposure to air pollution is associated with an increased risk of metabolic dysfunction-associated fatty liver disease Association between cataract extraction and development of dementia Cockayne Syndrome B protein selectively resolves and interact with intermolecular DNA G-quadruplex structures Total synthesis of (−)-glionitrin A and B enabled by an asymmetric oxidative sulfenylation of triketopiperazines Injectable, pore‐forming, perfusable double‐network hydrogels resilient to extreme biomechanical stimulations Cell trafficking and regulation of osteoblastogenesis by extracellular vesicle associated bone morphogenetic protein Regulation of aged skeletal muscle regeneration by circulating extracellular vesicles β-Catenin-NF-κB-CFTR interactions in cholangiocytes regulate inflammation and fibrosis during ductular reaction Association of subcutaneous or intravenous route of administration of casirivimab and imdevimab monoclonal antibodies with clinical outcomes in COVID-19 Divergent COVID-19 Disease Trajectories Predicted by a DAMP-Centered Immune Network Model Physical therapy exerts sub-additive and suppressive effects on intracerebral neural stem cell implantation in a rat model of stroke Mammalian hybrid pre-autophagosomal structure HyPAS generates autophagosomes Neural optoelectrodes merging semiconductor scalability with polymeric-like bendability for low damage acute in vivo neuron readout and stimulation Inactivation of multidrug‐resistant bacteria and bacterial spores and generation of high‐potency bacterial vaccines using ultrashort pulsed lasers A multi-scale map of cell structure fusing protein images and interactions Neural nano-optics for high-quality thin lens imaging Reduction of glutamate neurotoxicity: A novel therapeutic approach for Niemann-Pick disease, type C1 Diet-induced alteration of intestinal stem cell function underlies obesity and prediabetes in mice Type I interferon activates MHC class I-dressed CD11b conventional dendritic cells to promote protective anti-tumor CD8 T cell immunity Targeting p21Cip1 highly expressing cells in adipose tissue alleviates insulin resistance in obesity Comprehensive chemical proteomics analyses reveal that the new TRi-1 and TRi-2 compounds are more specific thioredoxin reductase 1 inhibitors than auranofin Double-layered adhesive microneedle bandage based on biofunctionalized mussel protein for cardiac tissue regeneration Biopsy-free in vivo virtual histology of skin using deep learning Identification of astroglia-like cardiac nexus glia that are critical regulators of cardiac development and function Autocrine vitamin D signaling switches off pro-inflammatory programs of TH1 cells The genetic architecture of obsessive-compulsive disorder: contribution of liability to OCD From alleles across the frequency spectrum Rapid adaptation of brain–computer interfaces to new neuronal ensembles or participants via generative modelling COVID-19 genetic risk variants are associated with expression of multiple genes in diverse immune cell types Extreme heat and cardiovascular health: what a cardiovascular health professional should know Large-scale integration of single-cell transcriptomic data captures transitional progenitor states in mouse skeletal muscle regeneration Antisense therapy in a rat model of Alexander disease reverses GFAP pathology, white matter deficits, and motor impairment Intestinal microbiota shapes gut physiology and regulates enteric neurons and glia Coordination of fungal biofilm development by extracellular vesicle cargo CSF microRNAs reveal impairment of angiogenesis and autophagy in Parkinson disease Cell size is a determinant of stem cell potential during aging Concomitant tricuspid repair in patients with degenerative mitral regurgitation T cell receptor therapy targeting mutant capicua transcriptional repressor in experimental gliomas The 3p21.31 genetic locus promotes progression to type 1 diabetes through the CCR2/CCL2 pathway Posterior left pericardiotomy for the prevention of atrial fibrillation after cardiac surgery: an adaptive, single-centre, single-blind, randomised, controlled trial Novel genetic variants in MAPT and alterations in tau phosphorylation in amyotrophic lateral sclerosis post‐mortem motor cortex and cerebrospinal fluid Bioactive scaffolds with enhanced supramolecular motion promote recovery from spinal cord injury Identification of endotypes of hospitalized COVID-19 patients Furin cleavage of the SARS-CoV-2 spike is modulated by O-glycosylation Deletion of Abi3 gene locus exacerbates neuropathological features of Alzheimer’s disease in a mouse model of Aβ amyloidosis The metabolic adaptation evoked by arginine enhances the effect of radiation in brain metastases Durvalumab with platinum-pemetrexed for unresectable pleural mesothelioma: survival, genomic and immunologic analyses from the phase 2 PrE0505 trial Upper respiratory tract microbiome of Australian Aboriginal and Torres Strait Islander children in ear and nose health and disease The effects of fibrinogen’s interactions with its neuronal receptors, intercellular adhesion molecule-1 and cellular prion protein Rational prioritization strategy allows the design of macrolide derivatives that overcome antibiotic resistance Recruitment of dendritic cell progenitors to foci of influenza A virus infection sustains immunity Downregulation of erythrocyte miR-210 induces endothelial dysfunction in type 2 diabetes Hyperleptinemia in obese state renders luminal breast cancers refractory to tamoxifen by coordinating a crosstalk between Med1, miR205 and ErbB Impaired function and delayed regeneration of dendritic cells in COVID-19 Reprogramming CBX8-PRC1 function with a positive allosteric modulator Single-cell transcriptomics reveals a conserved metaplasia program in pancreatic injury In vivo rate-determining steps of tau seed accumulation in Alzheimer’s disease Clinically tractable outcome prediction of non-WNT/non-SHH medulloblastoma based on TPD52 immunohistochemistry in a multicohort study Closed-loop enhancement and neural decoding of cognitive control in humans Chemotherapy-induced changes in the lung microenvironment: the role of MMP-2 in facilitating intravascular arrest of breast cancer cells Context-dependent representations of movement in Drosophila dopaminergic reinforcement pathways Detection and characterization of thrombosis in humans using fibrin-targeted positron emission tomography and magnetic resonance An uncommon neuronal class conveys visual signals from rods and cones to retinal ganglion cells Blastocyst development after fertilization with in vitro spermatids derived from nonhuman primate embryonic stem cells Phase II study of ipilimumab and nivolumab in leptomeningeal carcinomatosis Genomic and transcriptomic correlates of immunotherapy response within the tumor microenvironment of leptomeningeal metastases Human ALS/FTD brain organoid slice cultures display distinct early astrocyte and targetable neuronal pathology Serial assessment of measurable residual disease in medulloblastoma liquid biopsies Activity-dependent modulation of synapse-regulating genes in astrocytes Phthalate and novel plasticizer concentrations in food items from U.S. fast food chains: a preliminary analysis Acoustic core–shell resonance harvester for application of artificial cochlea based on the piezo-triboelectric effect Morphodynamics facilitate cancer cells to navigate 3D extracellular matrix Deep neural network for detecting arbitrary precision peptide features through attention based segmentation Examining the cooperativity mode of antibody and CD8 T cell immune responses for vaccinology A non-reactive natural product precursor of the duocarmycin family has potent and selective antimalarial activity Computational repurposing of therapeutic small molecules from cancer to pulmonary hypertension Mutant clones in normal epithelium outcompete and eliminate emerging tumors 4D microstructural changes in dentinal tubules during acid demineralisation Introducing dorsoventral patterning in adult regenerating lizard tails with gene-edited embryonic neural stem cells Signatures of plasticity, metastasis, and immunosuppression in an atlas of human small cell lung cancer An endogenous opioid circuit determines state-dependent reward consumption Dendritic hydrogels induce immune modulation in human keratinocytes and effectively eradicate bacterial pathogens Accelerated discovery of 3D printing materials using data-driven multiobjective optimization Aged breast extracellular matrix drives mammary epithelial cells to an invasive and cancer‐like phenotype Mapping the proteo-genomic convergence of human diseases When makes you unique: Temporality of the human brain fingerprint scAAVengr, a transcriptome-based pipeline for quantitative ranking of engineered AAVs with single-cell resolution Ti3 C2 Tx MXene flakes for optical control of neuronal electrical activity Pneumococcal extracellular vesicles modulate host immunity Cell membrane coating integrity affects the internalization mechanism of biomimetic nanoparticles Oligodendrocytes enhance axonal energy metabolism by deacetylation of mitochondrial proteins through transcellular delivery of SIRT2 Prevalence of elevated serum fatty acid synthase in chronic limb-threatening ischemia miR-766-5p targets super-enhancers by downregulating CBP and BRD4 Fibrin gel enhances the antitumor effects of chimeric antigen receptor T cells in glioblastoma Integrative RNA-omics discovers GNAS alternative splicing as a phenotypic driver of splicing factor-mutant neoplasms Foxq2 determines blue cone identity in zebrafish Population-specific neuromodulation prolongs therapeutic benefits of deep brain stimulation Harnessing 3D collagen hydrogel-directed conversion of human GMSCs into SCP-like cells to generate functionalized nerve conduits A multimodal cell census and atlas of the mammalian primary motor cortex Engineering of a functional pancreatic acinus with reprogrammed cancer cells by induced PTF1a expression Epigenetic encoding, heritability and plasticity of glioma transcriptional cell states Restoration of visual function and cortical connectivity after ischemic injury through neuroD1-mediated gene therapy A 3D flexible neural interface based on a microfluidic interconnection cable capable of chemical delivery Adults with Crohn’s disease exhibit elevated gynoid fat and reduced android fat irrespective of disease relapse or remission NSG-Pro mouse model for uncovering resistance mechanisms and unique vulnerabilities in human luminal breast cancers Activation of microbiota sensing – free fatty acid receptor 2 signaling ameliorates amyloid-β induced neurotoxicity by modulating proteolysis-senescence axis Exploring the longitudinal glioma microenvironment landscape uncovers reprogrammed pro-tumorigenic neutrophils in the bone marrow Ultrasensitive multispecies spectroscopic breath analysis for real-time health monitoring and diagnostics Field-theoretic density estimation for biological sequence space with applications to 5′ splice site diversity and aneuploidy in cancer Effect of convalescent plasma on organ support–free days in critically ill patients with COVID-19: a randomized clinical trial Evolutionary analysis of the Delta and Delta Plus variants of the SARS-CoV-2 viruses Attenuation of peripheral serotonin inhibits tumor growth and enhances immune checkpoint blockade therapy in murine tumor models Inter-mosaic coordination of retinal receptive fields Scene statistics and noise determine the relative arrangement of receptive field mosaics Aberrant gut-microbiota-immune-brain axis development in premature neonates with brain damage A microenvironment-inspired synthetic three-dimensional model for pancreatic ductal adenocarcinoma organoids Limited access to antigen drives generation of early B cell memory while restraining the plasmablast response Human exposure to respiratory aerosols in a ventilated room: Effects of ventilation condition, emission mode, and social distancing Synthesis of human amyloid restricted to liver results in an Alzheimer disease–like neurodegenerative phenotype Epithelial memory of inflammation limits tissue damage while promoting pancreatic tumorigenesis Application of zwitterionic polymer hydrogels to optical tissue clearing for 3D fluorescence imaging A CRISPR/Cas9 genetically engineered organoid biobank reveals essential host factors for coronaviruses Differential requirement for the Polycomb repressor complex 2 in dendritic cell and tissue-resident myeloid cell homeostasis Structure and efflux mechanism of the yeast pleiotropic drug resistance transporter Pdr5 A MATLAB-based program for three-dimensional quantitative analysis of micronuclei reveals that neuroinflammation induces micronuclei formation in the brain Radiation-activated secretory proteins of Scgb1a1 club cells increase the efficacy of immune checkpoint blockade in lung cancer Decision trees within a molecular memristor Developmental chromatin programs determine oncogenic competence in melanoma Call for emergency action to limit global temperature increases, restore biodiversity, and protect health Single-nuclei transcriptomes from human adrenal gland reveal distinct cellular identities of low and high-risk neuroblastoma tumors GRHL3 activates FSCN1 to relax cell-cell adhesions between migrating keratinocytes during wound reepithelialization Complement factor C1q mediates sleep spindle loss and epileptic spikes after mild brain injury Midterm outcomes of a prospective, nonrandomized study to evaluate endovascular repair of complex aortic aneurysms using fenestrated-branched endografts Repurposing RNA sequencing for discovery of RNA modifications in clinical cohorts Bimodal nanocomposite platform with antibiofilm and self-powering functionalities for biomedical applications Tumor-induced cardiac dysfunction: a potential role of ROS Neurorobotic fusion of prosthetic touch, kinesthesia, and movement in bionic upper limbs promotes intrinsic brain behaviors Large-scale cis- and trans-eQTL analyses identify thousands of genetic loci and polygenic scores that regulate blood gene expression The immunostimulatory RNA RN7SL1 enables CAR-T cells to enhance autonomous and endogenous immune function T cell protein tyrosine phosphatase protects intestinal barrier function by restricting epithelial tight junction remodeling A reservoir of stem-like CD8 T cells in the tumor-draining lymph node preserves the ongoing anti-tumor immune response Engineered miniature CRISPR-Cas system for mammalian genome regulation and editing Analysis of features of Alzheimer’s disease: detection of early stage from functional brain changes in magnetic resonance images using a finetuned ResNet18 network Long-term treatment with senolytic drugs Dasatinib and Quercetin ameliorates age-dependent intervertebral disc degeneration in mice Integrated analysis of plasma and single immune cells uncovers metabolic changes in individuals with COVID-19 Genomic and evolutionary classification of lung cancer in never smokers A learning health system randomized trial of monoclonal antibodies for Covid-19 LAG-3 expression on peripheral blood cells identifies patients with poorer outcomes after immune checkpoint blockade Microglial activation and tau propagate jointly across Braak stages Health impact and cost-effectiveness of achieving the national salt and sugar reduction initiative voluntary sugar reduction targets in the United States: a micro-simulation study 2021 ESC Guidelines on cardiovascular disease prevention in clinical practice The PEMDAC phase 2 study of pembrolizumab and entinostat in patients with metastatic uveal melanoma Mapping single-cell data to reference atlases by transfer learning Stretchable and bioadhesive gelatin methacryloyl-based hydrogels enabled by in situ dopamine polymerization Novel assessment of leukocyte-rich platelet rich plasma on functional and patient reported outcomes in knee osteoarthritis: a pilot study Mapping the dynamic transfer functions of eukaryotic gene regulation Transcriptional control of brain tumor stem cells by a carbohydrate binding protein 3D bioprinted multicellular vascular models Neuronal spreading and plaque induction of intracellular Aβ and its disruption of Aβ homeostasis Human iPS-derived pre-epicardial cells direct cardiomyocyte aggregation expansion and organization in vitro Mammalian retrovirus-like protein PEG10 packages its own mRNA and can be pseudotyped for mRNA delivery Detection and characterization of lung cancer using cell-free DNA fragmentomes Topography and permeability analyses of vasculature‐on‐a‐chip using scanning probe microscopies Synthetic extracellular matrices with tailored adhesiveness and degradability support lumen formation during angiogenic sprouting Sphingosine-1-phosphate interactions in the spleen and heart reflect extent of cardiac repair in mice and failing human hearts A potently neutralizing SARS-CoV-2 antibody inhibits variants of concern by utilizing unique binding residues in a highly conserved epitope Why exercise builds muscles: titin mechanosensing controls skeletal muscle growth under load Engineering aligned human cardiac muscle using developmentally inspired fibronectin micropatterns Exercise-induced angiogenesis is dependent on metabolically primed ATF3/4 endothelial cells TREM2 is thyroid hormone regulated making the TREM2 pathway druggable with ligands for thyroid hormone receptor Hypertrophic cardiomyopathy β-cardiac myosin mutation (P710R) leads to hypercontractility by disrupting super relaxed state Quantifying frequency content in cross-sectional retinal scans of diabetics vs. controls Structure of a meiosis-specific complex central to BRCA2 localization at recombination sites Long range synchronization within the enteric nervous system underlies propulsion along the large intestine in mice Place fields of single spikes in hippocampus involve Kcnq3 channel-dependent entrainment of complex spike bursts BET bromodomain protein inhibition reverses chimeric antigen receptor extinction and reinvigorates exhausted T cells in chronic lymphocytic leukemia Rapid induction of antigen-specific CD4+ T cells is associated with coordinated humoral and cellular immune responses to SARS-CoV-2 mRNA vaccination Neural recording and stimulation using wireless networks of microimplants Disruptor of telomeric silencing 1-like promotes ovarian cancer tumor growth by stimulating pro-tumorigenic metabolic pathways and blocking apoptosis A proteogenomic portrait of lung squamous cell carcinoma Biodegradable and dual‐responsive polypeptide‐shelled cyclodextrin‐containers for intracellular delivery of membrane‐impermeable cargo The CD155/TIGIT axis promotes and maintains immune evasion in neoantigen-expressing pancreatic cancer Panichmitochondria-targeted hydrogen sulfide delivery molecules protect against UVA-induced photoaging in dermal fibroblasts, and in mouse skin in vivo Aberrant cytoplasmic intron retention is a blueprint for RNA binding protein mislocalization in VCP-related amyotrophic lateral sclerosis TDP-43 and FUS mislocalization in VCP mutant motor neurons is reversed by pharmacological inhibition of the VCP D2 ATPase domain Sustained release of usnic acid from graphene coatings ensures long term antibiofilm protection Dileucine ingestion is more effective than leucine in stimulating muscle protein turnover in young males: a double blind randomized controlled trial Evaluating CRISPR-based prime editing for cancer modeling and CFTR repair in organoids Reinforcement learning links spontaneous cortical dopamine impulses to reward Drug‐eluting endotracheal tubes for preventing bacterial inflammation in subglottic stenosis Therapeutic anticoagulation with heparin in noncritically ill patients with COVID-19 Therapeutic anticoagulation with heparin in critically ill patients with COVID-19 Opportunities for biomanufacturing in low earth orbit: current status and future directions Chemically modified guide RNAs enhance CRISPR-Cas13 knockdown in human cells TROPHY-U-01: a phase II open-label study of sacituzumab govitecan in patients with metastatic urothelial carcinoma progressing after platinum-based chemotherapy and checkpoint inhibitors Modeling sporadic Alzheimer's disease in human brain organoids under serum exposure Genome-wide gene expression tuning reveals diverse vulnerabilities of M. tuberculosis Association of statin use with clinical outcomes in patients with triple-negative breast cancer Missing self–induced microvascular rejection of kidney allografts: a population-based study Microglia provide structural resolution to injured dendrites after severe seizures Magnetic assembly of a multifunctional guidance conduit for peripheral nerve repair PIP4Ks impact on PI3K, FOXP3, and UHRF1 signaling and modulate human regulatory T cell proliferation and immunosuppressive activity Recovery from acute SARS-CoV-2 infection and development of anamnestic immune responses in T cell-depleted rhesus macaques Unstable regulatory T cells, enriched for naïve and Nrp1neg cells, are purged after fate challenge Human tumor microenvironment chip evaluates the consequences of platelet extravasation and combinatorial antitumor-antiplatelet therapy in ovarian cancer Genomes for Kids: The scope of pathogenic mutations in pediatric cancer revealed by comprehensive DNA and RNA sequencing Fibroblast growth factor receptor 3 alterations and response to immune checkpoint inhibition in metastatic urothelial cancer: a real-world experience Chondroitin 6-sulphate is required for neuroplasticity and memory in ageing Dynamic loading of human engineered heart tissue enhances contractile function and drives a desmosome-linked disease phenotype An epigenetic switch regulates the ontogeny of AXL positive/EGFR-TKI resistant cells by modulating miR-335 expression Analysis of high‐risk pedigrees identifies 12 candidate variants for Alzheimer's disease Modulation of amyloid-β aggregation by metal complexes with a dual binding mode and their delivery across the blood–brain barrier using focused ultrasound Complex II subunit SDHD is critical for cell growth and metabolism, which can be partially restored with a synthetic ubiquinone analog Complex I protein NDUFS2 is vital for growth, ROS generation, membrane integrity, apoptosis, and mitochondrial energetics Association of monogenic and polygenic risk with the prevalence of open-angle glaucoma Genetic screens identify a context-specific PI3K/p27Kip1 node driving extrahepatic biliary cancer Restoring endogenous repair mechanisms to heal chronic wounds with a multifunctional wound dressing Structure-guided microbial targeting of antistaphylococcal prodrugs Autoantibodies stabilize neutrophil extracellular traps in COVID-19 Transcriptional regulation of N6-methyladenosine orchestrates sex-dimorphic metabolic traits Superantigenic character of an insert unique to SARS-CoV-2 spike supported by skewed TCR repertoire in patients with hyperinflammation Hepatocyte nuclear factor 4 alpha 2 messenger RNA reprograms liver-enriched transcription factors and functional proteins in end-stage cirrhotic human hepatocytes Chronic lung diseases are associated with gene expression programs favoring SARS-CoV-2 entry and severity A SNAI2-PEAK1-INHBA stromal axis drives progression and lapatinib resistance in HER2-positive breast cancer by supporting subpopulations of tumor cells positive for antiapoptotic and stress signaling markers Biochemical characteristics and clinical result of bone marrow–derived fibrin clot for repair of isolated meniscal injury in the avascular zone GABA-receptive microglia selectively sculpt developing inhibitory circuits Huntingtin silencing delays onset and slows progression of Huntington’s disease: a biomarker study Down-regulation of A20 promotes immune escape of lung adenocarcinomas Nuclear factor E2-related factor 2 (NRF2) deficiency accelerates fast fiber type transition in soleus muscle during space flight De-scattering with Excitation Patterning enables rapid wide-field imaging through scattering media Gut microbiome heritability is nearly universal but environmentally contingent Biomaterial vaccines capturing pathogen-associated molecular patterns protect against bacterial infections and septic shock Dose-response meta-analysis on tooth loss with the risk of cognitive impairment and dementia Metabolic control of TFH cells and humoral immunity by phosphatidylethanolamine Compensatory hepatic adaptation accompanies permanent absence of intrahepatic biliary network due to YAP1 loss in liver progenitors An acellular biologic scaffold treatment for volumetric muscle loss: results of a 13-patient cohort study Matrix bound nanovesicle-associated IL-33 activates a pro-remodeling macrophage phenotype via a non-canonical, ST2-independent pathway Immunogenicity of COVID-19 vaccination in immunocompromised patients: an observational, prospective cohort study interim analysis When the human brain goes diving: using near-infrared spectroscopy to measure cerebral and systemic cardiovascular responses to deep, breath-hold diving in elite freedivers Pervasive inflammatory activation in patients with deficiency in very-long-chain acyl-coA dehydrogenase (VLCADD) Therapeutic ultrasound triggered silk fibroin scaffold degradation Pharmaceutical design and development of perfluorocarbon nanocolloids for oxygen delivery in regenerative medicine A single stiffened nucleus alters cell dynamics and coherence in a monolayer Pelvic floor shape variations during pregnancy and after vaginal delivery The immune response is a critical regulator of zebrafish retinal pigment epithelium regeneration Partial recovery of visual function in a blind patient after optogenetic therapy A brain-computer interface that evokes tactile sensations improves robotic arm control Treg cell-derived osteopontin promotes microglia-mediated white matter repair after ischemic stroke B1a and B2 cells are characterized by distinct CpG modification states at DNMT3A-maintained enhancers Discovery of first-in-class inhibitors of ASH1L histone methyltransferase with anti-leukemic activity Retinal imaging demonstrates reduced capillary density in clinically unimpaired APOE ε4 gene carriers Targeting human Acyl-CoA:cholesterol acyltransferase as a dual viral and T cell metabolic checkpoint Left atrial appendage occlusion during cardiac surgery to prevent stroke Upregulation of VCAM-1 in lymphatic collectors supports dendritic cell entry and rapid migration to lymph nodes in inflammation Lysine demethylase 5A is required for MYC-driven transcription in multiple myeloma Mucosal acidosis elicits a unique molecular signature in epithelia and intestinal tissue mediated by GPR31-induced CREB phosphorylation Selection of metastasis competent subclones in the tumor interior Large-scale plasma proteomic analysis identifies proteins and pathways associated with dementia risk Impact of bamlanivimab monoclonal antibody treatment on hospitalization and mortality among non-hospitalized adults with SARS-CoV-2 infection Tympanostomy tubes or medical management for recurrent acute otitis media Colonization of the Caenorhabditis elegans gut with human enteric bacterial pathogens leads to proteostasis disruption that is rescued by butyrate Antibody response to 2-dose SARS-CoV-2 mRNA vaccine series in solid organ transplant recipients Transcriptional analysis of cystic fibrosis airways at single-cell resolution reveals altered epithelial cell states and composition Feeling younger as a stress buffer: Subjective age moderates the effect of perceived stress on change in functional health ALIX and ceramide differentially control polarized small extracellular vesicle release from epithelial cells The COVID-19 puzzle: deciphering pathophysiology and phenotypes of a new disease entity Engineering of diseased human skin equivalent using 3D cell printing for representing pathophysiological hallmarks of type 2 diabetes in vitro Prognostic value of lower bone mineral density in predicting adverse cardiovascular disease in Asian women Inner hair cell stereocilia are embedded in the tectorial membrane Cardiovascular risk factor trajectories since childhood and cognitive performance in midlife: The Cardiovascular Risk in Young Finns Study AIF3 splicing switch triggers neurodegeneration A molecular single-cell lung atlas of lethal COVID-19 Mimicking associative learning using an ion-trapping non-volatile synaptic organic electrochemical transistor Minimally invasive electroceutical catheter for endoluminal defect sealing Intranasal vaccination with influenza HA/GO-PEI nanoparticles provides immune protection against homo- and heterologous strains Thresholds of polarization vision in octopuses Studying tumor angiogenesis and cancer invasion in a three‐dimensional vascularized breast cancer micro‐environment Engineering T cells to express tumoricidal MDA-7/IL-24 enhances cancer immunotherapy Roughness and dynamics of proliferating cell fronts as a probe of cell–cell interactions Vesicular glutamate transporter modulates sex differences in dopamine neuron vulnerability to age-related neurodegeneration Fast skeletal myosin-binding protein-C regulates fast skeletal muscle contraction VPS39-deficiency observed in type 2 diabetes impairs muscle stem cell differentiation via altered autophagy and epigenetics Perivascular macrophages regulate blood flow following tissue damage Investigating the nature of active forces in tissues reveals how contractile cells can form extensile monolayers Positive allosteric modulation of the mu-opioid receptor produces analgesia with reduced side effects Single virus inductively coupled plasma mass spectroscopy analysis: A comprehensive study Intra‐operative bioprinting of hard, soft, and hard/soft composite tissues for craniomaxillofacial reconstruction Fabrication of cartilage-inspired hydrogel/entangled polymer–elastomer structures possessing poro-elastic properties Loneliness and social isolation increase cancer incidence in a cohort of Finnish middle-aged men: a longitudinal study Chaperone-mediated autophagy prevents collapse of the neuronal metastable proteome Cyclic peptide FXII inhibitor provides safe anticoagulation in a thrombosis model and in artificial lungs Combination of polycarboxybetaine coating and factor XII inhibitor reduces clot formation while preserving normal tissue coagulation during extracorporeal life support The biphasic and age-dependent impact of Klotho on hallmarks of aging and skeletal muscle function A stromal progenitor and ILC2 niche promotes muscle eosinophilia and fibrosis-associated gene expression Modular complement assemblies for mitigating inflammatory conditions Assessment of cumulative incidence and severity of primary open-angle glaucoma among participants in the ocular hypertension treatment study after 20 years of follow-up Genome-wide programmable transcriptional memory by CRISPR-based epigenome editing Activity-regulated synaptic targeting of lncRNA ADEPTR mediates structural plasticity by localizing Sptn1 and AnkB in dendrites Integrated computer-aided engineering and design for DNA assemblies An intercrypt subpopulation of goblet cells is essential for colonic mucus barrier function Inhibition of macrophage histone demethylase JMJD3 protects against abdominal aortic aneurysms PI3Kγ inhibition suppresses microglia/TAM accumulation in glioblastoma microenvironment to promote exceptional temozolomide response Safety and improved efficacy signals following gene therapy in childhood blindness caused by GUCY2D mutations Treatment patterns and clinical outcomes after the introduction of the Medicare sepsis performance measure (SEP-1) Outcomes after sentinel lymph node biopsy and radiotherapy in older women with early-stage, estrogen receptor–positive breast cancer Silencing of LINE-1 retrotransposons is a selective dependency of myeloid leukemia Stabilization of damaged articular cartilage with hydrogel‐mediated reinforcement and sealing Periodontal dysbiosis associates with reduced CSF Aβ42 in cognitively normal elderly A bacterial small RNA regulates the adaptation of Helicobacter pylori to the host environment Vascular smooth muscle-derived Trpv1 progenitors are a source of cold-induced thermogenic adipocytes Bisphenols exert detrimental effects on neuronal signaling in mature vertebrate brains Epidemiology and risk factors for the development of cutaneous toxicities in patients treated with immune checkpoint inhibitors: A United States population-level analysis Direct continuous electromyographic control of a powered prosthetic ankle for improved postural control after guided physical training: A case study Integration of multiomics data with graph convolutional networks to identify new cancer genes and their associated molecular mechanisms Suboptimal response to COVID-19 mRNA vaccines in hematologic malignancies patients Antibody responses in elderly residential care persons following COVID-19 mRNA vaccination Intracellular action potential recordings from cardiomyocytes by ultrafast pulsed laser irradiation of fuzzy graphene microelectrodes The NIH Somatic Cell Genome Editing Program All-trans retinoic acid induces synaptic plasticity in human cortical neurons High-throughput fitness screening and transcriptomics identify a role for a type IV secretion system in the pathogenesis of Crohn’s disease-associated Escherichia coli Whole‐genome sequencing reveals new Alzheimer's disease–associated rare variants in loci related to synaptic function and neuronal development DeepTCR is a deep learning framework for revealing sequence concepts within T-cell repertoires PANDORA-seq expands the repertoire of regulatory small RNAs by overcoming RNA modifications Incremental change versus disruptive transformation: COVID-19 and the cardiovascular community Avoiding the coming tsunami of common, chronic disease: what the lessons of the COVID-19 pandemic can teach us Soluble α-synuclein/antibody complexes activate the NLRP3 inflammasome in hiPSC-derived microglia Sequencing of 53,831 diverse genomes from the NHLBI TOPMed Program Specific populations of basal ganglia output neurons target distinct brain stem areas while collateralizing throughout the diencephalon Examining sleep deficiency and disturbance and their risk for incident dementia and all-cause mortality in older adults across 5 years in the United States Open-source, 3D-printed peristaltic pumps for small volume point-of-care liquid handling Material characterisation and stratification of conjunctival epithelial cells on electrospun poly(e-caprolactone) fibres loaded with decellurised tissue matrices Impact of monoclonal antibody treatment on hospitalization and mortality among non-hospitalized adults with SARS-CoV-2 infection Genetic basis of lacunar stroke: a pooled analysis of individual patient data and genome-wide association studies Clonal architecture in mesothelioma is prognostic and shapes the tumour microenvironment Reciprocal control of obesity and anxiety–depressive disorder via a GABA and serotonin neural circuit Proteasome stress in skeletal muscle mounts a long-range protective response that delays retinal and brain aging Cardiac effects of repeated weightlessness during extreme duration swimming compared with spaceflight Massively parallel sequencing of esophageal brushings enables an aneuploidy-based classification of patients with Barrett’s esophagus Active carpets drive non-equilibrium diffusion and enhanced molecular fluxes Structural insights into the function of the catalytically active human Taspase1 Glycine and N‐acetylcysteine (GlyNAC) supplementation in older adults improves glutathione deficiency, oxidative stress, mitochondrial dysfunction, inflammation, insulin resistance, endothelial dysfunction,... Enrichment of skeletal stem cells from human bone marrow using spherical nucleic acids Healthy aging and the blood–brain barrier Cancer cells escape autophagy inhibition via NRF2-induced macropinocytosis Skeletal muscle regeneration via the chemical induction and expansion of myogenic stem cells in situ or in vitro Recognition of non-CpG repeats in Alu and ribosomal RNAs by the Z-RNA binding domain of ADAR1 induces A-Z junctions Are recent cohorts getting worse? Trends in U.S. adult physiological status, mental health, and health behaviors across a century of birth cohorts trans-Translation inhibitors bind to a novel site on the ribosome and clear Neisseria gonorrhoeae in vivo Evolution of late-stage metastatic melanoma is dominated by aneuploidy and whole genome doubling Identification of bacteria-derived HLA-bound peptides in melanoma Neuronal circuits overcome imbalance in excitation and inhibition by adjusting connection numbers US hospital capacity managers’ experiences and concerns regarding preparedness for seasonal influenza and influenza-like illness Physiologic improvement in respiratory acidosis using extracorporeal Co2 removal with Hemolung Respiratory Assist System in the management of severe respiratory failure from coronavirus disease 2019 Allogeneic adipose‐derived stem cells mitigate acute radiation syndrome by the rescue of damaged bone marrow cells from apoptosis Chemical pumps and flexible sheets spontaneously form self-regulating oscillators in solution TLR3-activated monocyte-derived dendritic cells trigger progression from acute viral infection to chronic disease in the lung Potent and selective knockdown of Tyrosine Kinase 2 by antisense oligonucleotides In-vivo sub-diffraction adaptive optics imaging of photoreceptors in the human eye with annular pupil illumination and sub-Airy detection ADAR1 RNA editing enzyme regulates R-loop formation and genome stability at telomeres in cancer cells Diabetes induces dysregulation of microRNAs associated with survival, proliferation and self-renewal in cardiac progenitor cells Link between mild traumatic brain injury, poor sleep, and MRI-visible perivascular spaces in Veterans Chemotherapy induces senescence-like resilient cells capable of initiating AML recurrence A primary care agenda for brain health: a scientific statement from the American Heart Association Hyperinsulinemia and insulin resistance in the obese may develop as part of a homeostatic response to elevated free fatty acids: A mechanistic case-control and a population-based cohort study Antibody resistance of SARS-CoV-2 variants B.1.351 and B.1.1.7 Cellular plasticity balances the metabolic and proliferation dynamics of a regenerating liver Brain microvasculature has a common topology with local differences in geometry that match metabolic load Heterologous arenavirus vector prime-boost overrules self-tolerance for efficient tumor-specific CD8 T cell attack Accelerating target deconvolution for therapeutic antibody candidates using highly parallelized genome editing Discovery and validation of a urinary exosome mRNA signature for the diagnosis of human kidney transplant rejection Association between vision impairment and mortality: a systematic review and meta-analysis Patient-derived xenografts and organoids model therapy response in prostate cancer In vivo reprogramming of NG2 glia enables adult neurogenesis and functional recovery following spinal cord injury Machine learning identifies candidates for drug repurposing in Alzheimer’s disease Circulating tumour DNA from the cerebrospinal fluid allows the characterisation and monitoring of medulloblastoma Immune cell profiling of the cerebrospinal fluid enables the characterization of the brain metastasis microenvironment Inhibition of ATGL in adipose tissue ameliorates isoproterenol-induced cardiac remodeling by reducing adipose tissue inflammation Induction of four‐dimensional spatiotemporal geometric transformations in high cell density tissues via shape‐changing hydrogels Transdermal electroosmotic flow generated by a porous microneedle array patch A sparse multiscale nonlinear autoregressive model for seizure prediction Estimating risk of mechanical ventilation and in-hospital mortality among adult COVID-19 patients admitted to Mass General Brigham: The VICE and DICE scores Pseudomonas aeruginosa aggregates in cystic fibrosis sputum produce exopolysaccharides that likely impede current therapies Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization SARS-CoV-2 causes a different cytokine response compared to other cytokine storm-causing respiratory viruses in severely ill patients Exacerbation of epilepsy by astrocyte alkalization and gap junction uncoupling Reversible self-assembly of superstructured networks Superstructured biomaterials formed by exchange dynamics and host–guest interactions in supramolecular polymers Association of hypertensive disorders of pregnancy with left ventricular remodeling later in life Self‐assembling nanofibers inhibit inflammation in a murine model of Crohn's‐disease‐like ileitis Structural basis for differential recognition of phosphohistidine-containing peptides by 1-pHis and 3-pHis monoclonal antibodies A unifying framework for mean-field theories of asymmetric kinetic Ising systems Cellular stress signaling activates type-I IFN response through FOXO3-regulated lamin posttranslational modification The one-carbon pool controls mitochondrial energy metabolism via complex I and iron-sulfur clusters Functional skeletal muscle regeneration with thermally drawn porous fibers and reprogrammed muscle progenitors for volumetric muscle injury Longitudinal transcriptomics define the stages of myeloid activation in the living human brain after intracerebral hemorrhage Mechanism of membrane-tethered mitochondrial protein synthesis Novel AAV capsids for intravitreal gene therapy of photoreceptor disorders Massive expansion of human gut bacteriophage diversity Macrophages provide a transient muscle stem cell niche via NAMPT secretion Use of the MyProstateScore test to rule out clinically significant cancer: validation of a straightforward clinical testing approach Dual targeting of polyamine synthesis and uptake in diffuse intrinsic pontine gliomas Genome evolution and the emergence of pathogenicity in avian Escherichia coli Regulatory inter-domain interactions influence Hsp70 recruitment to the DnaJB8 chaperone Inhibitory CD161 receptor identified in glioma-infiltrating T cells by single-cell analysis Genome-wide meta-analysis of muscle weakness identifies 15 susceptibility loci in older men and women Lenvatinib plus pembrolizumab or everolimus for advanced renal cell carcinoma Agonist-antagonist myoneural interface amputation preserves proprioceptive sensorimotor neurophysiology in lower limbs Neural interfacing architecture enables enhanced motor control and residual limb functionality postamputation Dopamine regulates pancreatic glucagon and insulin secretion via adrenergic and dopaminergic receptors Tibiofemoral bony morphology features associated with ACL injury and sex utilizing three-dimensional statistical shape modeling A Fbxo48 inhibitor prevents pAMPKα degradation and ameliorates insulin resistance Nrf2 and β-catenin coactivation in hepatocellular cancer: Biological and therapeutic implications Scaffolding protein IQGAP1 is dispensable but its overexpression promotes hepatocellular carcinoma via YAP1 signaling Barriers to kidney transplantation in racial/ethnic minorities Social determinants of health and race disparities in kidney transplant ITIH4 acts as a protease inhibitor by a novel inhibitory mechanism TALEN outperforms Cas9 in editing heterochromatin target sites The association of dilated perivascular spaces with cognitive decline and incident dementia Lysine acetyltransferase Tip60 is required for hematopoietic stem cell maintenance AIM2 in regulatory T cells restrains autoimmune diseases Asynchronous release sites align with NMDA receptors in mouse hippocampal synapses Somatic reversion of pathogenic DOCK8 variants alters lymphocyte differentiation and function to effectively cure DOCK8 deficiency Epidermal progenitors suppress GRHL3-mediated differentiation through intronic polyadenylation promoted by CPSF-HNRNPA3 collaboration Differentiation of the 50B11 dorsal root ganglion cells into NGF and GDNF responsive nociceptor subtypes Clinical performance and utility of a comprehensive next-generation sequencing DNA panel for the simultaneous analysis of variants, TMB and MSI for myeloid neoplasms Glutaminase inhibition with telaglenastat (CB-839) improves treatment response in combination with ionizing radiation in head and neck squamous cell carcinoma models AMPK induces regulatory innate lymphoid cells after traumatic brain injury Gut-licensed IFNγ NK cells drive LAMP1 TRAIL anti-inflammatory astrocytes Targeting OCT3 attenuates doxorubicin-induced cardiac injury Association of ambient air pollution with age-related macular degeneration and retinal thickness in UK Biobank The Apex bileaflet mechanical heart valve Soft subdermal implant capable of wireless battery charging and programmable controls for applications in optogenetics Bacterial and fungal profiles as markers of infliximab drug response in inflammatory bowel disease Synthetic bone‐like structures through omnidirectional ceramic bioprinting in cell suspensions Evolution of antibody immunity to SARS-CoV-2 Extracellular vesicles promote transkingdom nutrient transfer during viral-bacterial co-infection Adaptive remodeling in the elastase-induced rabbit aneurysms Actin-binding protein profilin1 promotes aggressiveness of clear-cell renal cell carcinoma cells Prioritized research for the prevention, treatment, and reversal of chronic disease: recommendations from the Lifestyle Medicine Research Summit In-vivo efficacy of biodegradable ultrahigh ductility Mg-Li-Zn alloy tracheal stents for pediatric airway obstruction EGR1 is a gatekeeper of inflammatory enhancers in human macrophages Cabozantinib for neurofibromatosis type 1–related plexiform neurofibromas: a phase 2 trial Referral rates for cardiac rehabilitation among eligible inpatients after implementation of a default opt-out decision pathway in the electronic medical record Epigenetic targeting of Waldenström macroglobulinemia cells with BET inhibitors synergizes with BCL2 or histone deacetylase inhibition Protein-bound molybdenum cofactor is bioavailable and rescues molybdenum cofactor-deficient C. elegans Targeting cartilage EGFR pathway for osteoarthritis treatment Emergency response for evaluating SARS-CoV-2 immune status, seroprevalence and convalescent plasma in Argentina Transneuronal delivery of hyper-interleukin-6 enables functional recovery after severe spinal cord injury in mice Learning the language of viral evolution and escape Post-transcriptional gene regulation by microRNA-194 promotes neuroendocrine transdifferentiation in prostate cancer Limited rejuvenation of aged hematopoietic stem cells in young bone marrow niche The intestinal parasite Cryptosporidium is controlled by an enterocyte intrinsic inflammasome that depends on NLRP6 Local blood coagulation drives cancer cell arrest and brain metastasis in a mouse model A pro-carcinogenic colon microbe promotes breast tumorigenesis and metastatic progression and concomitantly activates Notch and βcatenin axes How do the blind 'see'? The role of spontaneous brain activity in self-generated perception The SIRPα–CD47 immune checkpoint in NK cells Pathway-based classification of glioblastoma uncovers a mitochondrial subtype with therapeutic vulnerabilities A single immunization with spike-functionalized ferritin vaccines elicits neutralizing antibody responses against SARS-CoV-2 in mice Gene therapy for tuberous sclerosis complex type 2 in a mouse model by delivery of AAV9 encoding a condensed form of tuberin Non-canonical Wnt/PCP signalling regulates intestinal stem cell lineage priming towards enteroendocrine and Paneth cell fates ECM hydrogel improves the delivery of PEG microsphere-encapsulated neural stem cells and endothelial cells into tissue cavities caused by stroke Smaller regional brain volumes predict posttraumatic stress disorder at 3 months after mild traumatic brain injury Oral azacitidine maintenance therapy for acute myeloid leukemia in first remission Metastasis and immune evasion from extracellular cGAMP hydrolysis Stopping renin-angiotensin system inhibitors in patients with advanced CKD and risk of adverse outcomes: a nationwide study The neural mechanisms underlying processing speed deficits in individuals who have sustained a spinal cord injury: a pilot study STING agonist promotes CAR T cell trafficking and persistence in breast cancer Blocking pro-inflammatory platelet-activating factor receptors and activating cell survival pathways: A novel therapeutic strategy in experimental ischemic stroke Distinct developmental pathways from blood monocytes generate human lung macrophage diversity Perivascular mesenchymal cells control adipose-tissue macrophage accrual in obesity Identification and characterization of novel bronchodilator agonists acting at human airway smooth muscle cell TAS2R5 IspH inhibitors kill gram-negative bacteria and mobilize immune clearance Reactivation of dormant tumor cells by modified lipids derived from stress-activated neutrophils Fibronectin-based nanomechanical biosensors to map 3D surface strains in live cells and tissue Glycoengineering of NK cells with glycan ligands of CD22 and selectins for B‐cell lymphoma therapy Long-range phase synchronization of high-frequency oscillations in human cortex Gene dosage manipulation alleviates manifestations of hereditary PAX6 haploinsufficiency in mice A macrophage-specific lncRNA regulates apoptosis and atherosclerosis by tethering HuR in the nucleus Extraembryonic endoderm (XEN) cells capable of contributing to embryonic chimeras established from pig embryos Rheological investigation of collagen, fibrinogen, and thrombin solutions for drop-on-demand 3D bioprinting Quinine copolymer reporters promote efficient intracellular DNA delivery and illuminate a protein-induced unpackaging mechanism Synergistic combination of calcium and citrate in mesoporous nanoparticles targets pleural tumors Neurologic syndromes predict higher in-hospital mortality in COVID-19 Dissociating antibacterial from ototoxic effects of gentamicin C-subtypes Bilateral visual improvement with unilateral gene therapy injection for Leber hereditary optic neuropathy Revealing nanoscale mineralization pathways of hydroxyapatite using in situ liquid cell transmission electron microscopy Trends in prevalence of blindness and distance and near vision impairment over 30 years: an analysis for the Global Burden of Disease Study Causes of blindness and vision impairment in 2020 and trends over 30 years, and prevalence of avoidable blindness in relation to VISION 2020: the Right to Sight: an analysis for the Global Burden of Disease Study Pharmacological reversal of synaptic and network pathology in human MECP2 ‐KO neurons and cortical organoids The trans-kingdom battle between donor and recipient gut microbiome influences fecal microbiota transplantation outcome Reconstitution of a functional human thymus by postnatal stromal progenitor cells and natural whole-organ scaffolds Effect of gut microbiota on depressive-like behaviors in mice is mediated by the endocannabinoid system Single-nucleus transcriptomics reveals functional compartmentalization in syncytial skeletal muscle cells Transfer RNA fragments replace microRNA regulators of the cholinergic poststroke immune blockade Durable suppression of acquired MEK inhibitor resistance in cancer by sequestering MEK from ERK and promoting anti-tumor T-cell immunity Human‐specific polymorphic pseudogenization of SIGLEC12 protects against advanced cancer progression Survival and recurrence after intraperitoneal chemotherapy use: Retrospective review of ovarian cancer hospital registry data Developmental remodelling of non-CG methylation at satellite DNA repeats Islet vascularization is regulated by primary endothelial cilia via VEGF-A-dependent signaling Elongated neutrophil-derived structures are blood-borne microparticles formed by rolling neutrophils during sepsis COVID-19 severity is tripled in the diabetes community: a prospective analysis of the pandemic’s impact in type 1 and type 2 diabetes Integration of genomics and transcriptomics predicts diabetic retinopathy susceptibility genes Tipping the immunostimulatory and inhibitory DAMP balance to harness immunogenic cell death Senescence-associated secretory phenotype determines survival and therapeutic response in cervical cancer CSF tau microtubule binding region identifies tau tangle and clinical stages of Alzheimer’s disease Structural basis for α‐helix mimicry and inhibition of protein–protein interactions with oligourea foldamers Targeted deubiquitination rescues distinct trafficking-deficient ion channelopathies Gene regulatory network analysis and engineering directs development and vascularization of multilineage human liver organoids Cellular extrusion bioprinting improves kidney organoid reproducibility and conformation PD1 blockade enhances K channel activity, Ca2 signaling, and migratory ability in cytotoxic T lymphocytes of patients with head and neck cancer Optimized OPA1 Isoforms 1 and 7 provide therapeutic benefit in models of mitochondrial dysfunction Steps toward translocation-independent RNA polymerase inactivation by terminator ATPase ρ RNA-mediated control of cell shape modulates antibiotic resistance in Vibrio cholerae Mucosal immunity in COVID-19: a neglected but critical aspect of SARS-CoV-2 infection Inhibition of 3-phosphoinositide–dependent protein kinase 1 (PDK1) can revert cellular senescence in human dermal fibroblasts Accelerating bone healing in vivo by harnessing the age-altered activation of c-Jun N-terminal kinase 3 Gut microbiota depletion by chronic antibiotic treatment alters the sleep/wake architecture and sleep EEG power spectra in mice Targeting PAK4 to reprogram the vascular microenvironment and improve CAR-T immunotherapy for glioblastoma Associations between physical activity and changes in depressive symptoms and health-related quality of life across 7 years following roux-en-y gastric bypass surgery--a multicenter prospective cohort study FRESH 3D bioprinting a full-size model of the human heart Mavacamten favorably impacts cardiac structure in obstructive hypertrophic cardiomyopathy: EXPLORER-HCM CMR substudy analysis Time, pattern, and outcome of medulloblastoma relapse and their association with tumour biology at diagnosis and therapy: a multicentre cohort study Acceleration of biomolecule enrichment and detection with rotationally motorized opto-plasmonic microsensors and the working mechanism Dysregulated ribonucleoprotein granules promote cardiomyopathy in RBM20 gene-edited pigs Cancer-associated gain-of-function mutations activate a SWI/SNF-family regulatory hub Pharmacological validation of targets regulating CD14 during macrophage differentiation Tissue topography steers migrating Drosophila border cells Enzyme-mediated nitric oxide production in vasoactive erythrocyte membrane-enclosed coacervate protocells Increasing kinase domain proximity promotes MST2 autophosphorylation during Hippo signaling Bone marrow adipogenic lineage precursors (MALPs) promote osteoclastogenesis in bone remodeling and pathologic bone loss Three-dimensional directional nerve guide conduits fabricated by dopamine-functionalized conductive carbon nanofibre-based nanocomposite ink printing Viscoelastic properties of biopolymer hydrogels determined by Brillouin spectroscopy: A probe of tissue micromechanics Suppression of DNA double-strand break formation by DNA polymerase β in active DNA demethylation is required for development of hippocampal pyramidal neurons Bundle analytics, a computational framework for investigating the shapes and profiles of brain pathways across populations Integrated morphoelectric and transcriptomic classification of cortical GABAergic cells Whole-genome sequencing and gene network modules predict gemcitabine/carboplatin-induced myelosuppression in non-small cell lung cancer patients Wnt-regulated lncRNA discovery enhanced by in vivo identification and CRISPRi functional validation Repetitive elements trigger RIG-I-like receptor signaling that regulates the emergence of hematopoietic stem and progenitor cells JAK inhibition reduces SARS-CoV-2 liver infectivity and modulates inflammatory responses to reduce morbidity and mortality The potassium channel subunit Kvβ1 serves as a major control point for synaptic facilitation Effect of hydroxychloroquine on clinical status at 14 days in hospitalized patients with COVID-19--a randomized clinical trial Variant-to-gene-mapping analyses reveal a role for the hypothalamus in genetic susceptibility to inflammatory bowel disease A randomised controlled feasibility trial of E-health application supported care vs usual care after exacerbation of COPD: the RESCUE trial Network-based machine learning in colorectal and bladder organoid models predicts anti-cancer drug efficacy in patients Changes in membrane dielectric properties of porcine kidney cells provide insight into the antiviral activity of glycine An epicardial bioelectronic patch made from soft rubbery materials and capable of spatiotemporal mapping of electrophysiological activity Bacterial retrons function in anti-phage defense Heterozygous cystic fibrosis transmembrane regulator gene missense variants are associated with worse cardiac function in patients with Duchenne Muscular Dystrophy Selective inhibition of CDK7 reveals high-confidence targets and new models for TFIIH function in transcription 3D bioprinted highly elastic hybrid constructs for advanced fibrocartilaginous tissue regeneration Diagnostics of melanocytic skin tumors by a combination of ultrasonic, dermatoscopic and spectrophotometric image parameters Evolving trends in adult heart transplant with the 2018 heart allocation policy change Visualizing a protonated RNA state that modulates microRNA-21 maturation Use of hormone replacement therapy and risk of breast cancer: nested case-control studies using the QResearch and CPRD databases Tunable dynamics of B cell selection in gut germinal centres A human tissue screen identifies a regulator of ER secretion as a brain size determinant Physical traits of cancer IL6 fuels durable memory for Th17 cell–mediated responses to tumors Conditional protein tagging methods reveal highly specific subcellular distribution of ion channels in motion-sensing neurons Structural neuroplastic responses preserve functional connectivity and neurobehavioural outcomes in children born without corpus callosum Elicitation of potent neutralizing antibody responses by designed protein nanoparticle vaccines for SARS-CoV-2 Early emergence of T central memory precursors programs clonal dominance during chronic viral infection Development and validation of a clinical prognostic stage group system for nonmetastatic prostate cancer using disease-specific mortality results from the international staging collaboration for cancer of the prostate Predicting drug response and synergy using a deep learning model of human cancer cells Kindlin-3 loss curbs chronic myeloid leukemia in mice by mobilizing leukemic stem cells from protective bone marrow niches Multimodal mapping of the tumor and peripheral blood immune landscape in human pancreatic cancer The DEL-1/β3 integrin axis promotes regulatory T cell responses during inflammation resolution Somatic mutations in UBA1 and severe adult-onset autoinflammatory disease Exploring high aspect ratio gold nanotubes as cytosolic agents: structural engineering and uptake into mesothelioma cells Bilateral distance partition of periventricular and deep white matter hyperintensities: performance of the method in the aging brain Metabolomics profiling of critically ill coronavirus disease 2019 patients: identification of diagnostic and prognostic biomarkers Glioma-derived IL-33 orchestrates an inflammatory brain tumor microenvironment that accelerates glioma progression Validation of a core patient-reported outcome measure for fatigue in patients receiving hemodialysis The VASP-profilin1 (Pfn1) interaction is critical for efficient cell migration and is regulated by cell-substrate adhesion in a PKA-dependent manner TLR4 signaling and macrophage inflammatory responses are dampened by GIV/Girdin Bimodal neuromodulation combining sound and tongue stimulation reduces tinnitus symptoms in a large randomized clinical study Long‐term survival of participants in the CENTAUR trial of sodium phenylbutyrate‐taurursodiol in ALS Positive selection within the genomes of SARS-CoV-2 and other Coronaviruses independent of impact on protein function Microglial autophagy-associated phagocytosis is essential for recovery from neuroinflammation Electrothermal soft manipulator enabling safe transport and handling of thin cell/tissue sheets and bioelectronic devices The nucleus acts as a ruler tailoring cell responses to spatial constraints Dynamic bio‐barcode assay enables electrochemical detection of a cancer biomarker in undiluted human plasma: a sample‐in‐answer‐out approach eIF2α controls memory consolidation via excitatory and somatostatin neurons Endothelial extracellular vesicles contain protective proteins and rescue ischemia-reperfusion injury in a human heart-on-chip Disease trajectory browser for exploring temporal, population-wide disease progression patterns in 7.2 million Danish patients Gene regulatory networks controlling vertebrate retinal regeneration High‐throughput magnetic actuation platform for evaluating the effect of mechanical force on 3D tumor microenvironment Silk fibroin nanofibers: a promising ink additive for extrusion three-dimensional bioprinting Fine structural tuning of the assembly of ECM peptide conjugates via slight sequence modifications Monoclonal immunoglobulins promote bone loss in multiple myeloma MP-Pt(IV): A MAOB-sensitive mitochondrial-specific prodrug for treating glioblastoma Expansion of the phenotypic spectrum of de novo missense variants in kinesin family member 1A (KIF1A) Coupling of NMDA receptors and TRPM4 guides discovery of unconventional neuroprotectants Nonfatal opioid overdoses at an urban emergency department during the COVID-19 pandemic Excess deaths from COVID-19 and other causes, March-April 2020 Excess deaths from COVID-19 and other causes, March-July 2020 Theory of mechanochemical patterning and optimal migration in cell monolayers A pathoconnectome of early neurodegeneration: Network changes in retinal degeneration Tumoural activation of TLR3–SLIT2 axis in endothelium drives metastasis Stress fiber anisotropy contributes to force-mode dependent chromatin stretching and gene upregulation in living cells Maresin-1 and Resolvin E1 promote regenerative properties of periodontal ligament stem cells under inflammatory conditions Real-world data from a molecular tumor board demonstrates improved outcomes with a precision N-of-One strategy Systolic blood pressure reduction and acute kidney injury in intracerebral hemorrhage Combinational therapy with antibiotics and antibiotic-loaded adipose-derived stem cells reduce abscess formation in implant-related infection in rats Non-invasive molecularly-specific millimeter-resolution manipulation of brain circuits by ultrasound-mediated aggregation and uncaging of drug carriers Lack of NFATc1 SUMOylation prevents autoimmunity and alloreactivity Progressing the field of Regenerative Rehabilitation through novel interdisciplinary interaction Superantigenic character of an insert unique to SARS-CoV-2 spike supported by skewed TCR repertoire in patients with hyperinflammation Protein aggregation and immunogenicity of biotherapeutics Untethered control of functional origami microrobots with distributed actuation Brain-first versus body-first Parkinson’s disease: a multimodal imaging case-control study Enhanced treatment strategies and distinct disease outcomes among autoantibody-positive and -negative rheumatoid arthritis patients over 25 years: A longitudinal cohort study in the Netherlands Patient trajectories among persons hospitalized for COVID-19 Obesity is associated with reduced plasticity of the human motor cortex A role for astroglial calcium in mammalian sleep and sleep regulation Extracorporeal membrane oxygenation support in COVID-19: an international cohort study of the Extracorporeal Life Support Organization registry Ethnic differences in alpha‐1 antitrypsin deficiency allele frequencies may partially explain national differences in COVID‐19 fatality rates Regulatory T cells suppress Th17 cell Ca2 signaling in the spinal cord during murine autoimmune neuroinflammation Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth Enabling early detection of osteoarthritis from presymptomatic cartilage texture maps via transport-based learning Mesoscale diffusion magnetic resonance imaging of the ex vivo human hippocampus Fully oxygen-tolerant atom transfer radical polymerization triggered by sodium pyruvate Point-of-care platform blood biomarker testing of glial fibrillary acidic protein versus S100 calcium-binding protein B for prediction of traumatic brain injuries: a transforming research and clinical knowledge in traumatic brain injury study Cells from discarded dressings differentiate chronic from acute wounds in patients with Epidermolysis Bullosa Glial metabolic rewiring promotes axon regeneration and functional recovery in the central nervous system Differential expression of tissue-restricted antigens among mTEC is associated with distinct autoreactive T cell fates Increased antioxidant capacity and pro-homeostatic lipid mediators in ocular hypertension—a human experimental model Astrocytes are necessary for blood–brain barrier maintenance in the adult mouse brain Identification of a nanomolar affinity α-synuclein fibril imaging probe by ultra-high throughput in silico screening Epineural optogenetic activation of nociceptors initiates and amplifies inflammation Machine learning guided 3D printing of tissue engineering scaffolds Effectiveness of 222-nm ultraviolet light on disinfecting SARS-CoV-2 surface contamination Heterochromatin-driven nuclear softening protects the genome against mechanical stress-induced damage Excess patient visits for cough and pulmonary disease at a large US health system in the months prior to the COVID-19 pandemic: time-series analysis Concanamycin A counteracts HIV-1 Nef to enhance immune clearance of infected primary cells by cytotoxic T lymphocytes A patient-based model of RNA mis-splicing uncovers treatment targets in Parkinson’s disease Selective inhibition of TGF-β1 produced by GARP-expressing Tregs overcomes resistance to PD-1/PD-L1 blockade in cancer Most commonly mutated genes in high-grade serous ovarian carcinoma are nonessential for ovarian surface epithelial stem cell transformation Microengineered 3D pulmonary interstitial mimetics highlight a critical role for matrix degradation in myofibroblast differentiation Determinants of telomere length across human tissues GFI1 functions to repress neuronal gene expression in the developing inner ear hair cells Porous microneedles on a paper for screening test of prediabetes Microfluidic label-free bioprocessing of human reticulocytes from erythroid culture Decidual vasculopathy identification in whole slide images using multiresolution hierarchical convolutional neural networks Improved testing and design of intubation boxes during the COVID-19 pandemic Effect of hydrocortisone on mortality and organ support in patients with severe COVID-19. The REMAP-CAP COVID-19 corticosteroid domain randomized clinical trial. Synthetic immunomodulation with a CRISPR super-repressor in vivo ACTIVATE: Randomized clinical trial of BCG vaccination against infection in the elderly Effective combination immunotherapy using oncolytic viruses to deliver CAR targets to solid tumors Multiphase assembly of small molecule microcrystalline peptide hydrogel allows immunomodulatory combination therapy for long‐term heart transplant survival An in vitro model of chronic wounding and its implication for age-related macular degeneration Smad7 enhances TGF-β-induced transcription of c-Jun and HDAC6 promoting invasion of prostate cancer cells A cell-autonomous signature of dysregulated protein phosphorylation underlies muscle insulin resistance in type 2 diabetes Structure of a human 48S translational initiation complex Trans-ethnic and ancestry-specific blood-cell genetics in 746,667 individuals from 5 global populations Phenotypical and functional alteration of unconventional T cells in severe COVID-19 patients Association of anticholinergic medication and AD biomarkers with incidence of MCI among cognitively normal older adults Host lymphotoxin-β receptor signaling is crucial for angiogenesis of metanephric tissue transplanted into lymphoid sites Kidney–in–a–lymph node: A novel organogenesis assay to model human renal development and test nephron progenitor cell fates Ex vivo cell therapy by ectopic hepatocyte transplantation treats the porcine tyrosinemia model of acute liver failure Single-cell transcriptome analysis of colon cancer cell response to 5-fluorouracil-induced DNA damage Sustained release of a GLP-1 and FGF21 dual agonist from an injectable 2 depot protects mice from obesity and hyperglycemia Phase 1 study of TTC-352 in patients with metastatic breast cancer progressing on endocrine and CDK4/6 inhibitor therapy Atomistic structure and dynamics of the human MHC-I peptide-loading complex SARS-CoV-2 infectivity and neurological targets in the brain 3D printed patient-specific aortic root models with internal sensors for minimally invasive applications 2020 ESC Guidelines on sports cardiology and exercise in patients with cardiovascular disease: The Task Force on sports cardiology and exercise in patients with cardiovascular disease of the European Society of Cardiology (ESC) IL-6 trans-signaling induces plasminogen activator inhibitor-1 from vascular endothelial cells in cytokine release syndrome A synthetic synaptic organizer protein restores glutamatergic neuronal circuits Engineered spider silk-based 2D and 3D materials prevent microbial infestation Development of ectopic livers by hepatocyte transplantation into swine lymph nodes High‐protein diet more effectively reduces hepatic fat than low‐protein diet despite lower autophagy and FGF21 levels Immune-modulatory alginate protects mesenchymal stem cells for sustained delivery of reparative factors to ischemic myocardium Distinct regulatory programs control the latent regenerative potential of dermal fibroblasts during wound healing Engineered off-the-shelf therapeutic T cells resist host immune rejection PKD1-dependent renal cystogenesis in human induced pluripotent stem cell-derived ureteric bud/collecting duct organoids A single-dose intranasal ChAd vaccine protects upper and lower respiratory tracts against SARS-CoV-2 Design of a small molecule that stimulates vascular endothelial growth factor A enabled by screening RNA fold–small molecule interactions EEF1A1 deacetylation enables transcriptional activation of remyelination 1-Deoxysphingolipids cause autophagosome and lysosome accumulation and trigger NLRP3 inflammasome activation The gut virome database reveals age-dependent patterns of virome diversity in the human gut Replication-competent vesicular stomatitis virus vaccine vector protects against SARS-CoV-2-mediated pathogenesis in mice Sex differences in pharmacokinetics predict adverse drug reactions in women Integrated metabolic and epigenomic reprograming by H3K27M mutations in diffuse intrinsic pontine gliomas Co‐occurrence of antibiotic, biocide, and heavy metal resistance genes in bacteria from metal and radionuclide contaminated soils at the Savannah River Site Distinct fibroblast subsets regulate lacteal integrity through YAP/TAZ-induced VEGF-C in intestinal villi Immune monitoring facilitates the clinical decision in multifocal COVID‐19 of a pancreas‐kidney transplant patient Enabling and promoting walking rehabilitation by paired associative stimulation after incomplete paraplegia: a case report Prognostic gene expression signature for high-grade serous ovarian cancer Mitochondrial dynamics in postmitotic cells regulate neurogenesis Disease-associated KIF3A variants alter gene methylation and expression impacting skin barrier and atopic dermatitis risk Cyclic peptide FXII inhibitor provides safe anticoagulation in a thrombosis model and in artificial lungs Differential recovery rates of fitness following U.S. Army Ranger training Hydrogel−solid hybrid materials for biomedical applications enabled by surface‐embedded radicals Temporal pressure enhanced topical drug delivery through micropore formation Cxcl9l and Cxcr3.2 regulate recruitment of osteoclast progenitors to bone matrix in a medaka osteoporosis model Insulin2Q104del (Kuma) mutant mice develop diabetes with dominant inheritance DHA modulates MANF and TREM2 abundance, enhances neurogenesis, reduces infarct size, and improves neurological function after experimental ischemic stroke The association between biomarkers and clinical outcomes in novel coronavirus pneumonia in a US cohort A point mutation decouples the lipid transfer activities of microsomal triglyceride transfer protein Primary human colonic mucosal barrier crosstalk with super oxygen-sensitive Faecalibacterium prausnitzii in continuous culture Abnormal liver tests in COVID‐19: a retrospective observational cohort study of 1827 patients in a major U.S. hospital network A short de novo synthesis of nucleoside analogs Flexible usage and interconnectivity of diverse cell death pathways protect against intracellular infection DNA capture by a CRISPR-Cas9–guided adenine base editor VRK-1 extends life span by activation of AMPK via phosphorylation The architecture and stabilisation of flagellotropic tailed bacteriophages A unified catalog of 204,938 reference genomes from the human gut microbiome Identification of an anti-diabetic, orally available small molecule that regulates TXNIP expression and glucagon action Surface tension nanogates for controlled ion transport PiggyBac mutagenesis and exome sequencing identify genetic driver landscapes and potential therapeutic targets of EGFR-mutant gliomas Structural and mechanistic analysis of ATPase inhibitors targeting mycobacterial DNA gyrase The optic nerve lamina region is a neural progenitor cell niche Breast reconstruction using a 3-dimensional absorbable mesh scaffold and autologous fat grafting: a composite strategy using tissue engineering principles Characterization of astrocytic response after experiencing cavitation in vitro The cytokine IL-17A limits Th17 pathogenicity via a negative feedback loop driven by autocrine induction of IL-24 Phage therapy for limb-threatening prosthetic knee klebsiella pneumoniae infection: case report and in vitro characterization of anti-biofilm activity Asymmetric clustering of centrosomes defines the early evolution of tetraploid cells Non-neuronal expression of SARS-CoV-2 entry genes in the olfactory system suggests mechanisms underlying COVID-19-associated anosmia Chaperone-mediated autophagy regulates the pluripotency of embryonic stem cells Transcriptome-wide off-target RNA editing induced by CRISPR-guided DNA base editors CRISPR C-to-G base editors for inducing targeted DNA transversions in human cells Temporal signatures of criticality in human cortical excitability as probed by early somatosensory responses Developmental attenuation of neuronal apoptosis by neural-specific splicing of Bak1 microexon 3D printing of microgel‐loaded modular microcages as instructive scaffolds for tissue engineering Depicting brighter possibilities for treating blindness A cytoskeleton regulator AVIL drives tumorigenesis in glioblastoma Standard gastroenterologist versus multidisciplinary treatment for functional gastrointestinal disorders (MANTRA): an open-label, single-centre, randomised controlled trial Microrheological characterization of covalent adaptable hydrogel degradation in response to temporal pH changes that mimic the gastrointestinal tract The endogenous neuronal complement inhibitor SRPX2 protects against complement-mediated synapse elimination during development Reliability and validity of an enhanced paper grip test; a simple clinical test for assessing lower limb strength Magnetic vortex nanodiscs enable remote magnetomechanical neural stimulation Maltotriose conjugated metal–organic frameworks for selective targeting and photodynamic therapy of triple negative breast cancer cells and tumor associated macrophages Safety and immunogenicity of the ChAdOx1 nCoV-19 vaccine against SARS-CoV-2: a preliminary report of a phase 1/2, single-blind, randomised controlled trial Encouraging results from phase 1/2 COVID-19 vaccine trials Immunogenicity and safety of a recombinant adenovirus type-5-vectored COVID-19 vaccine in healthy adults aged 18 years or older: a randomized, double-blind, placebo-controlled, phase 2 trial An mRNA vaccine against SARS-CoV-2 -- preliminary report Sensory restoration by epidural stimulation of the lateral spinal cord in upper-limb amputees Heart transplantation from biventricular support in infant with novel SMYD1 mutation Evaluation of a simulation-based mini-elective on medical student interest in cardiac surgery Young eosinophils rejuvenate ageing adipose tissues Eosinophils regulate adipose tissue inflammation and sustain physical and immunological fitness in old age Suprachoroidal gene transfer with nonviral nanoparticles Excessive astrocytic GABA causes cortical hypometabolism and impedes functional recovery after subcortical stroke Synaptic plasticity induced by differential manipulation of tonic and phasic motoneurons in Drosophila Comprehensive palmitoyl-proteomic analysis identifies distinct protein signatures for large and small cancer-derived extracellular vesicles A role of the frontotemporal lobar degeneration risk factor TMEM106B in myelination Extrapulmonary manifestations of COVID-19 Quantitative cellular-resolution map of the oxytocin receptor in postnatally developing mouse brains Positional isomers of a non-nucleoside substrate differentially affect myosin function Reduced-intensity single-unit unrelated cord blood transplant with optional immune boost for nonmalignant disorders Remote nongenetic optical modulation of neuronal activity using fuzzy graphene In situ electrochemical generation of nitric oxide for neuronal modulation Suppression of adenosine-to-inosine (A-to-I) RNA editome by death associated protein 3 (DAP3) promotes cancer progression Abnormal scaffold attachment factor 1 expression and localisation in spinocerebellar ataxias and Huntington’s chorea Chemical gradients in human enamel crystallites Repeated FIB-4 measurements can help identify individuals at risk of severe liver disease Single-dose mRNA therapy via biomaterial-mediated sequestration of overexpressed proteins Type V collagen in scar tissue regulates the size of scar after heart injury PARGT: a software tool for predicting antimicrobial resistance in bacteria Boceprevir, GC-376, and calpain inhibitors II, XII inhibit SARS-CoV-2 viral replication by targeting the viral main protease Relationship between oxygen consumption and neuronal activity in a defined neural circuit Enhancement of abiraterone acetate oral bioavailability by supersaturated-silica lipid hybrids Mesencephalic astrocyte–derived neurotrophic factor is an ER-resident chaperone that protects against reductive stress in the heart Highly parallel lab evolution reveals that epistasis can curb the evolution of antibiotic resistance Targeted delivery of mitochondria to the liver in rats Serum urate lowering with allopurinol and kidney function in type 1 diabetes Economic evaluation of Faecal microbiota transplantation compared to antibiotics for the treatment of recurrent Clostridioides difficile infection Studies on the mechanisms of anti-inflammatory activity of heparin- and hyaluronan-containing multilayer coatings—targeting NF-κB signalling pathway Infectability of human brainsphere neurons suggests neurotropism of SARS-CoV-2 Epicardial transplantation of atrial appendage micrograft patch salvages myocardium after infarction Hybrid gene origination creates human-virus chimeric proteins during infection Fibroblast–tumor cell signaling limits HER2 kinase therapy response via activation of MTOR and antiapoptotic pathways Patient genetics is linked to chronic wound microbiome composition and healing Manipulating synthetic optogenetic odors reveals the coding logic of olfactory perception Distinct pseudokinase domain conformations underlie divergent activation mechanisms among vertebrate MLKL orthologues MLKL trafficking and accumulation at the plasma membrane control the kinetics and threshold for necroptosis A missense mutation in the MLKL brace region promotes lethal neonatal inflammation and hematopoietic dysfunction Deconstructing sarcomeric structure–function relations in titin-BioID knock-in mice Use of the prevented fraction for the population to determine deaths averted by existing prevalence of physical activity: a descriptive study Partitioning of cancer therapeutics in nuclear condensates The atypical chemokine receptor ACKR3/CXCR7 is a broad-spectrum scavenger for opioid peptides Targeted phototherapy for malignant pleural mesothelioma: near-infrared photoimmunotherapy targeting podoplanin Rejuvenation of three germ layers tissues by exchanging old blood plasma with saline-albumin Very fast CRISPR on demand Redox lipid reprogramming commands susceptibility of macrophages and microglia to ferroptotic death Lipidomics and RNA sequencing reveal a novel subpopulation of nanovesicle within extracellular matrix biomaterials A SARS-CoV-2 infection model in mice demonstrates protection by neutralizing antibodies ALS/FTD mutations in UBQLN2 impede autophagy by reducing autophagosome acidification through loss of function Retinal ganglion cells with a glaucoma OPTN(E50K) mutation exhibit neurodegenerative phenotypes when derived from three-dimensional retinal organoids MHC class I and II peptide homology regulates the cellular immune response Skeletal muscle antagonizes antiviral CD8 T cell exhaustion Neural metabolic imbalance induced by MOF dysfunction triggers pericyte activation and breakdown of vasculature Association of circadian abnormalities in older adults with an increased risk of developing Parkinson Disease Bioresorbable, miniaturized porous silicon needles on a flexible water-soluble backing for unobtrusive, sustained delivery of chemotherapy Tumour predisposition and cancer syndromes as models to study gene–environment interactions Isolation of potent SARS-CoV-2 neutralizing antibodies and protection from disease in a small animal model Untangling the potential of carbon quantum dots in neurodegenerative disease TMEM16A deficiency: a potentially fatal neonatal disease resulting from impaired chloride currents Photoenzymatic enantioselective intermolecular radical hydroalkylation Cephalopod-inspired optical engineering of human cells Restoring light sensitivity using tunable near-infrared sensors Development of CRISPR as an antiviral strategy to combat SARS-CoV-2 and influenza Glutamine depletion regulates Slug to promote EMT and metastasis in pancreatic cancer Mitochondrial uncoupler BAM15 reverses diet-induced obesity and insulin resistance in mice Magnetoelectric materials for miniature, wireless neural stimulation at therapeutic frequencies Nucleosides rescue replication-mediated genome instability of human pluripotent stem cells PIRs mediate innate myeloid cell memory to nonself MHC molecules Biological and clinical characteristics of gene carriers far from predicted onset in the Huntington's disease Young Adult Study (HD-YAS): a cross-sectional analysis PGE1 and PGA1 bind to Nurr1 and activate its transcriptional function Hepatic NADH reductive stress underlies common variation in metabolic traits Localization of sterols and oxysterols in mouse brain reveals distinct spatial cholesterol metabolism Spread of pathological tau proteins through communicating neurons in human Alzheimer's disease Characterization of the development of the mouse cochlear epithelium at the single cell level Rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisolone combined with high-dose methotrexate plus intrathecal chemotherapy for newly diagnosed intravascular large B-cell lymphoma (PRIMEUR-IVL): a multicentre, single-arm, phase 2 trial Americans’ COVID-19 stress, coping, and adherence to CDC guidelines Synaptic actions of Amyotrophic Lateral Sclerosis-associated G85R-SOD1 in the squid giant synapse STING and IRF3 in stromal fibroblasts enable sensing of genomic stress in cancer cells to undermine oncolytic viral therapy Assembly and function of a bioengineered human liver for transplantation generated solely from induced pluripotent stem cells Use of ECCO2R with the Hemolung RAS in the treatment of severe hypercapnic respiratory failure caused by SARS-CoV-2 acute lung injury Decellularization techniques and their applications for the repair and regeneration of the nervous system Control of ecological outcomes through deliberate parameter changes in a model of the gut microbiome Reconfigurations within resonating communities of brain regions following TMS reveal different scales of processing De novo protein design enables the precise induction of RSV-neutralizing antibodies Enhancer reprogramming driven by high-order assemblies of transcription factors promotes phenotypic plasticity and breast cancer endocrine resistance Toward neuroprosthetic real-time communication from in silico to biological neuronal network via patterned optogenetic stimulation Acetylation of Aβ42 at lysine 16 disrupts amyloid formation Exploring theoretical and experimental optimization towards high-performance triboelectric nanogenerators using microarchitecture silk cocoon films Triterpenoid acids isolated from Schinus terebinthifolia fruits reduce Staphylococcus aureus virulence and abate dermonecrosis Safety, tolerability, and immunogenicity of a recombinant adenovirus type-5 vectored COVID-19 vaccine: a dose-escalation, open-label, non-randomized, first-in-human trial Common germline variants of the human APOE gene modulate melanoma progression and survival In vivo measurement of widespread synaptic loss in Alzheimer's disease with SV2A PET Variants that affect function of calcium channel TRPV6 are associated with early-onset chronic pancreatitis Hydroxychloroquine in patients with mainly mild to moderate coronavirus disease 2019: open label, randomized controlled trial Clinical efficacy of hydroxychloroquine in patients with covid-19 pneumonia who require oxygen: observational comparative study using routine care data Targeting two-component systems uncovers a small-molecule inhibitor of Salmonella virulence Multimodal coherent imaging of retinal biomarkers of Alzheimer’s disease in a mouse model Influence of pre-freezing conditions of octacalcium phosphate and collagen composite for reproducible appositional bone formation Cardiovascular complications in COVID-19 MicroRNA-9 fine-tunes dendritic cell function by suppressing negative regulators in a cell-type-specific manner HDAC1 modulates OGG1-initiated oxidative DNA damage repair in the aging brain and Alzheimer’s disease General anesthetics activate a potent central pain-suppression circuit in the amygdala Examination of food consumption in United States adults and the prevalence of inflammatory bowel disease using National Health Interview Survey 2015 Somatic mTOR mutation in clonally expanded T lymphocytes associated with chronic graft versus host disease Anti-human CD117 CAR T-cells efficiently eliminate healthy and malignant CD117-expressing hematopoietic cells Mitochondrial fission mediates endothelial inflammation Single-cell RNA-seq with spike-in cells enables accurate quantification of cell-specific drug effects in pancreatic islets ST2 as checkpoint target for colorectal cancer immunotherapy An occult HPV-driven oropharyngeal squamous cell carcinoma discovered through a saliva test Real-time tracking of self-reported symptoms to predict potential COVID-19 A non-canonical inhibitory circuit dampens behavioral sensitivity to light Upregulating Lin28a promotes axon regeneration in adult mice with optic nerve and spinal cord injury Dual-functional plasmonic photothermal biosensors for highly accurate severe acute respiratory syndrome coronavirus 2 detection B-type natriuretic peptide is upregulated by c-Jun N-terminal kinase and contributes to septic hypotension Separase-triggered apoptosis enforces minimal length of mitosis Region-specific transcriptional control of astrocyte function oversees local circuit activities Pandemics and the great evolutionary mismatch 3D characterisation of dry powder inhaler formulations: Developing X-ray micro computed tomography approaches Hippocampal synaptic plasticity, spatial memory, and neurotransmitter receptor expression are profoundly altered by gradual loss of hearing ability Cathepsin S regulates antigen processing and T cell activity in non-Hodgkin lymphoma Structural basis for transcriptional start site control of HIV-1 RNA fate SARS-CoV-2 receptor ACE2 is an interferon-stimulated gene in human airway epithelial cells and is detected in specific cell subsets across tissues Can keratin scaffolds be used for creating three-dimensional cell cultures? Bacterial metabolism of bile acids promotes generation of peripheral regulatory T cells A segregated cortical stream for retinal direction selectivity Tuft cell formation reflects epithelial plasticity in pancreatic injury: implications for modeling human pancreatitis Molecular and cellular differences in cardiac repair of male and female mice Selective PP2A enhancement through biased heterotrimer stabilization Deep learning method for mandibular canal segmentation in dental cone beam computed tomography volumes Circulating cell-free DNA is predominantly composed of retrotransposable elements and non-telomeric satellite DNA Evaluation of host-based molecular markers for the early detection of human sepsis Vascular permeability in retinopathy is regulated by VEGFR2 Y949 signaling to VE-cadherin Identification of calcium and integrin‐binding protein 1 as a novel regulator of production of amyloid β peptide using CRISPR/Cas9‐based screening system An off-the-shelf artificial cardiac patch improves cardiac repair after myocardial infarction in rats and pigs Vascular supply of the human spiral ganglion: novel three-dimensional analysis using synchrotron phase-contrast imaging and histology FABP4: a new player in obesity-associated breast cancer A CRISPR-based assay for the detection of opportunistic infections post-transplantation and for the monitoring of transplant rejection Loss of ELF5–FBXW7 stabilizes IFNGR1 to promote the growth and metastasis of triple-negative breast cancer through interferon-γ signalling Reactivation of Myc transcription in the mouse heart unlocks its proliferative capacity Minimum epistasis interpolation for sequence-function relationships Single-cell transcriptomics identifies an effectorness gradient shaping the response of CD4 T cells to cytokines Single-dose, intranasal immunization with recombinant parainfluenza virus 5 expressing middle east respiratory syndrome coronavirus (MERS-CoV) spike protein protects mice from fatal MERS-CoV infection Activity in grafted human iPS cell–derived cortical neurons integrated in stroke-injured rat brain regulates motor behavior Exercise rejuvenates quiescent skeletal muscle stem cells in old mice through restoration of Cyclin D1 Optimizing the trade-off between learning and doing in a pandemic Fusing randomized trials with big data the key to self-learning health care systems? The randomized embedded multifactorial adaptive platform for community-acquired pneumonia (REMAP-CAP) study: rationale and design Cardiac myosin promotes thrombin generation and coagulation in vitro and in vivo Cysteine depletion induces pancreatic tumor ferroptosis in mice Application of mild hypothermia successfully mitigates neural injury in a 3D in-vitro model of traumatic brain injury Recapitulating the human segmentation clock with pluripotent stem cells Myosin II filament dynamics in actin networks revealed with interferometric scattering microscopy A dual effect of ursolic acid to the treatment of multiple sclerosis through both immunomodulation and direct remyelination Ligand-mediated targeting of cytokine Interleukin-27 enhances its bioactivity in vivo SARS-CoV-2 receptor ACE2 and TMPRSS2 are primarily expressed in bronchial transient secretory cells Grip strength cut points for diabetes risk among apparently healthy U.S. adults Inhibition of SARS-CoV-2 infections in engineered human tissues using clinical-grade soluble human ACE2 Twist again: Dynamically and reversibly controllable chirality in liquid crystalline elastomer microposts Microneedle array delivered recombinant coronavirus vaccines: Immunogenicity and rapid translational development Deep remission at 1 year prevents progression of early Crohn’s disease Discovery of a novel integron-borne aminoglycoside resistance gene present in clinical pathogens by screening environmental bacterial communities Regulation of biomolecular-motor-driven cargo transport by microtubules under mechanical stress Association between cardiovascular disease and long-term exposure to air pollution with the risk of dementia The pan-cancer landscape of prognostic germline variants in 10,582 patients Sensitive and specific multi-cancer detection and localization using methylation signatures in cell-free DNA Sugar-induced obesity and insulin resistance are uncoupled from shortened survival in drosophila Effect of different exercise programs on non-specific chronic low back pain and disability in people who perform sedentary work Ultrasensitive detection of nucleic acids using deformed graphene channel field effect biosensors Aerosol and surface stability of SARS-CoV-2 as compared with SARS-CoV-1 Transient non-integrative expression of nuclear reprogramming factors promotes multifaceted amelioration of aging in human cells New systematic therapies and trends in cutaneous melanoma deaths among US whites, 1986–2016 Defining epidermal basal cell states during skin homeostasis and wound healing using single-cell transcriptomics Identification of non–small cell lung cancer sensitive to systemic cancer therapies using radiomics Precontrolled alignment of graphite nanoplatelets in polymeric composites prevents bacterial attachment Potently cytotoxic natural killer cells initially emerge from erythro-myeloid progenitors during mammalian development Human dental pulp stem cells exhibit enhanced properties in comparison to human bone marrow stem cells on neurites outgrowth Ameloblastomas exhibit stem cell potential, possess neurotrophic properties, and establish connections with trigeminal neurons Short-term modulation of the lesioned language network Functional recombinant apolipoprotein A5 that is stable at high concentrations at physiological pH Multi-scale predictions of drug resistance epidemiology identify design principles for rational drug design Microbiome analyses of blood and tissues suggest cancer diagnostic approach Treg-inducing microparticles promote donor-specific tolerance in experimental vascularized composite allotransplantation In situ recruitment of regulatory T cells promotes donor-specific tolerance in vascularized composite allotransplantation Impacts of Intralipid on nanodrug Abraxane therapy and on the innate immune system AAV gene therapy prevents and reverses heart failure in a murine knockout model of Barth Syndrome Multi-omics analysis of the intermittent fasting response in mice identifies an unexpected role for HNF4alpha Generation of human endothelium in pig embryos deficient in ETV2 Unraveling the complexity of amyloid polymorphism using gold nanoparticles and cryo-EM Cardiopoietic stem cell therapy restores infarction-altered cardiac proteome Analysis of DNA methylation associates the cystine–glutamate antiporter SLC7A11 with risk of Parkinson’s disease Tough ordered mesoporous elastomeric biomaterials formed at ambient conditions Anti-angiogenic effects of VEGF stimulation on endothelium deficient in phosphoinositide recycling Pan-cancer diagnostic consensus through searching archival histopathology images using artificial intelligence Serial interval of COVID-19 from publicly reported confirmed cases Disordered protein-graphene oxide co-assembly and supramolecular biofabrication of functional fluidic devices Photobactericidal activity activated by thiolated gold nanoclusters at low flux levels of white light Perivascular osteoprogenitors are associated with transcortical channels of long bones Biphasic chemotaxis of Escherichia coli to the microbiota metabolite indole Local targeted memory reactivation in human sleep Full-waveform inversion imaging of the human brain Structural basis of nucleosome assembly by the Abo1 AAA ATPase histone chaperone Vascular progenitors generated from tankyrase inhibitor-regulated naïve diabetic human iPSC potentiate efficient revascularization of ischemic retina A potent peptide-steroid conjugate accumulates in cartilage and reverses arthritis without evidence of systemic corticosteroid exposure A regenerative peripheral nerve interface allows real-time control of an artificial hand in upper limb amputees Toll‐like receptor 4 signaling in neurons enhances calcium‐permeable α‐amino‐3‐hydroxy‐5‐methyl‐4‐isoxazolepropionic acid receptor currents and drives post‐traumatic epileptogenesis Inhalation of lung spheroid cell secretome and exosomes promotes lung repair in pulmonary fibrosis Dual microglia effects on blood brain barrier permeability induced by systemic inflammation A cell atlas of human thymic development defines T cell repertoire formation Perceived healthiness of food items and the traffic light front of pack nutrition labelling: choice‐based conjoint analysis and cross‐sectional survey Complex human adenoid tissue-based ex vivo culture systems reveal anti-inflammatory drug effects on germinal center T and B cells Physiological tolerance to ssDNA enables strand uncoupling during DNA replication Early transmission dynamics in Wuhan, China, of novel coronavirus–infected pneumonia COVID-19: Navigating the uncharted Knockdown of long noncoding RNAs hepatocyte nuclear factor 1α antisense RNA 1 and hepatocyte nuclear factor 4α antisense RNA 1 alters susceptibility of acetaminophen-induced cytotoxicity in HepaRG cells Acetaminophen-induced liver injury alters expression and activities of cytochrome P450 enzymes in an age-dependent manner in mouse liver Lamina-dependent stretching and unconventional chromosome compartments in early C. elegans embryos A drug discovery platform to identify compounds that inhibit EGFR triple mutants Experimental glaucoma model with controllable intraocular pressure history Trypanosoma brucei Pex13.2 is an accessory peroxin that functions in the import of peroxisome targeting sequence type 2 proteins and localizes to subdomains of the glycosome High-throughput identification of post-transcriptional utrophin up-regulators for Duchenne muscle dystrophy (DMD) therapy Oral delivery of novel human IGF-1 bioencapsulated in lettuce cells promotes musculoskeletal cell proliferation, differentiation and diabetic fracture healing Continuous wearable monitoring analytics predict heart failure hospitalization Dysbiosis-induced secondary bile acid deficiency promotes intestinal inflammation Microglial depletion with CSF1R inhibitor during chronic phase of experimental traumatic brain injury reduces neurodegeneration and neurological deficits A cell atlas of human thymic development defines T cell repertoire formation A deep learning approach to antibiotic discovery Deformation of transvaginal mesh in response to multiaxial loading Urinary auto-brewery syndrome: a case report Opto-chemo-mechanical transduction in photoresponsive gels elicits switchable self-trapped beams with remote interactions Changes in smoking behavior before and after gastric bypass--a 7-year study Emerging patent landscape for non-viral vectors used for gene therapy Teprotumumab for the treatment of active thyroid eye disease The stress polarity signaling (SPS) pathway serves as a marker and a target in the leaky gut barrier: implications in aging and cancer Comparative molecular life history of spontaneous canine and human gliomas Human textiles: A cell-synthesized yarn as a truly “bio” material for tissue engineering applications Hyaluronic acid-based hydrogels with independently tunable mechanical and bioactive signaling features Analysis of interactions stabilized by Fusicoccin A reveals an expanded suite of potential 14–3–3 binding partners Glial remodeling enhances short-term memory performance in Wistar rats High-dimensional analysis of intestinal immune cells during helminth infection Pan-cancer analysis of whole genomes Patterns of somatic structural variation in human cancer genomes The repertoire of mutational signatures in human cancer How nurse practitioners spend their time in nursing facilities: revisited 20 years later A mechanochemical model of transcriptional bursting ATP13A2 deficiency disrupts lysosomal polyamine export Asymmetry in kinematic generalization between visual and passive lead-in movements are consistent with a forward model in the sensorimotor system Assisted reproduction mediated resurrection of a feline model for Chediak-Higashi syndrome caused by a large duplication in LYST BIG-TREE: base-edited isogenic hPSC line generation using a transient reporter for editing enrichment In pancreatic islets from type 2 diabetes patients, the dampened circadian oscillators lead to reduced insulin and glucagon exocytosis Signalling architectures can prevent cancer evolution Gamma visual stimulation induces a neuroimmune signaling profile distinct from acute neuroinflammation Tobacco smoking and somatic mutations in human bronchial epithelium Zucchini consensus motifs determine the mechanism of pre-piRNA production Tissue mechanics drives regeneration of a mucociliated epidermis on the surface of Xenopus embryonic aggregates GPR108 is a highly conserved AAV entry factor Blood contains circulating cell‐free respiratory competent mitochondria Identification of lineage-specific transcription factors that prevent activation of hepatic stellate cells and promote fibrosis resolution Tractions and stress fibers control cell shape and rearrangements in collective cell migration NP03, a microdose lithium formulation, blunts early amyloid post-plaque neuropathology in McGill-R-Thy1-APP Alzheimer-like transgenic rats A brief history of human disease genetics Effects of the microalgae Chlamydomonas on gastrointestinal health Somatic gene editing ameliorates skeletal and cardiac muscle failure in pig and human models of Duchenne muscular dystrophy iPSC modeling of young-onset Parkinson’s disease reveals a molecular signature of disease and novel therapeutic candidates Long-gap peripheral nerve repair through sustained release of a neurotrophic factor in nonhuman primates Hybrid erythrocyte liposomes: functionalized red blood cell membranes for molecule encapsulation Cerebellar neurodynamics predict decision timing and outcome on the single-trial level Enhancing hematopoiesis from murine embryonic stem cells through MLL1-induced activation of a Rac/Rho/integrin signaling axis A proteomic atlas of senescence-associated secretomes for aging biomarker development TBK1 is a synthetic lethal target in cancer with VHL loss Ribonucleotide reductase inhibitors suppress SAMHD 1 ara‐ CTP ase activity enhancing cytarabine efficacy Age-related alterations in inhibitory control investigated using the minimally delayed oculomotor response task Aluminum and amyloid-β in familial Alzheimer’s disease mTORC1 directly inhibits AMPK to promote cell proliferation under nutrient stress VEGF-C-driven lymphatic drainage enables immunosurveillance of brain tumours Effect of vitamin D3 supplementation on vascular and metabolic health of vitamin D–deficient overweight and obese children: a randomized clinical trial EasyPass: combating IoT delay with multiple access wireless side channels Global, regional, and national sepsis incidence and mortality, 1990–2017: analysis for the Global Burden of Disease Study 89Zr-immuno-PET: toward a noninvasive clinical tool to measure target engagement of therapeutic antibodies in vivo In vivo sequestration of innate small molecules to promote bone healing A large size-selective DNA nanopore with sensing applications Repression of phagocytosis by human CD33 is not conserved with mouse CD33 Mitochondrial DNA stress signalling protects the nuclear genome Chemical functionality of multidomain peptide hydrogels governs early host immune response Nicotinamide pathway-dependent Sirt1 activation restores calcium homeostasis to achieve neuroprotection in spinocerebellar ataxia type 7 Primary cilia signaling promotes axonal tract development and is disrupted in Joubert syndrome-related disorders models A bacterial gene-drive system efficiently edits and inactivates a high copy number antibiotic resistance locus Testing a MultiTEP-based combination vaccine to reduce Aβ and tau pathology in Tau22/5xFAD bigenic mice Prospective longitudinal atrophy in Alzheimer’s disease correlates with the intensity and topography of baseline tau-PET Prevention of tuberculosis in macaques after intravenous BCG immunization Braiding topology and the energy landscape of chromosome organization proteins The 111 study: a single-arm, phase 3 trial evaluating one cycle of bleomycin, etoposide, and cisplatin as adjuvant chemotherapy in high-risk, stage 1 nonseminomatous or combined germ cell tumours of the testis Structure of the cell-binding component of the Clostridium difficile binary toxin reveals a di-heptamer macromolecular assembly Syndecan-4 tunes cell mechanics by activating the kindlin-integrin-RhoA pathway Multiyear follow-up of AAV5-hFVIII-SQ gene therapy for Hemophilia A Proteomic analyses of decellularized porcine ovaries identified new matrisome proteins and spatial differences across and within ovarian compartments Vitamin lipid nanoparticles enable adoptive macrophage transfer for the treatment of multidrug-resistant bacterial sepsis Cranial irradiation mediated spine loss is sex-specific and complement receptor-3 dependent in male mice Relaxin reverses maladaptive remodeling of the aged heart through Wnt-signaling Neural stem cell extracellular vesicles disrupt midline shift predictive outcomes in porcine ischemic stroke model Polymeric sheet actuators with programmable bioinstructivity Cancer statistics, 2020 Translational regulation of non-autonomous mitochondrial stress response promotes longevity Outcomes of adult heart transplantation using hepatitis C–positive donors Extracellular matrix-based biomaterials and their influence upon cell behavior BPA: have flawed analytical techniques compromised risk assessments? External beam accelerated partial breast irradiation versus whole breast irradiation after breast conserving surgery in women with ductal carcinoma in situ and node-negative breast cancer (RAPID): a randomized controlled trial Nongenic cancer-risk SNPs affect oncogenes, tumor-suppressor genes, and immune function Molecular profiling of single neurons of known identity in two ganglia from the crab Cancer borealis Engineered E. coli Nissle 1917 for the delivery of matrix-tethered therapeutic domains to the gut Carboxylated branched poly(β-amino ester) nanoparticles enable robust cytosolic protein delivery and CRISPR-Cas9 gene editing NAIL-MS reveals the repair of 2-methylthiocytidine by AlkB in E. coli Unified mechanism of local drivers in a percolation model of atrial fibrillation Structure of the human metapneumovirus polymerase phosphoprotein complex CSB promoter downregulation via histone H3 hypoacetylation is an early determinant of replicative senescence Distinct tumor microenvironments of lytic and blastic bone metastases in prostate cancer patients Multi-layered core-sheath fiber membranes for controlled drug release in the local treatment of brain tumor Achieving spin-triplet exciton transfer between silicon and molecular acceptors for photon upconversion Functional organization of motor networks in the lumbosacral spinal cord of non-human primates Group A streptococcal S protein utilizes red blood cells as immune camouflage and is a critical determinant for immune evasion Molecular determinants of chaperone interactions on MHC-I for folding and antigen repertoire selection Proliferating transitory T Cells with an effector-like transcriptional signature emerge from PD-1 stem-like CD8 T cells during chronic infection MOWChIP-seq for low-input and multiplexed profiling of genome-wide histone modifications Eomes and Brachyury control pluripotency exit and germ-layer segregation by changing the chromatin state Specific inhibition of the NLRP3 inflammasome as an anti-inflammatory strategy in Cystic Fibrosis Effects of total sleep deprivation on procedural placekeeping: More than just lapses of attention Peritumoral activation of the Hippo pathway effectors Yap and Taz suppresses liver cancer in mice CRISPR/Cas13a‐powered electrochemical microfluidic biosensor for nucleic acid amplification‐free miRNA diagnostics Oral ionic liquid for the treatment of diet-induced obesity PTK2/FAK regulates UPS impairment via SQSTM1/p62 phosphorylation in TARDBP/TDP-43 proteinopathies Fructose-1,6-bisphosphatase 2 inhibits sarcoma progression by restraining mitochondrial biogenesis How many rare diseases are there? A Tppp3 Pdgfra tendon stem cell population contributes to regeneration and reveals a shared role for PDGF signalling in regeneration and fibrosis Caspase-8 is the molecular switch for apoptosis, necroptosis and pyroptosis Nucleolar dynamics and interactions with nucleoplasm in living cells Protective immunity against severe malaria in children is associated with a limited repertoire of antibodies to conserved PfEMP1 variants Rab5-mediated endosome formation is regulated at the trans-Golgi network P. aeruginosa lectin LecB impairs keratinocyte fitness by abrogating growth factor signalling Transcriptional regulatory model of fibrosis progression in the human lung Topology, geometry, and mechanics of strongly stretched and twisted filaments: solenoids, plectonemes, and artificial muscle fibers Positive and negative chemotaxis of enzyme-coated liposome motors Colorectal cancer-associated microbiota contributes to oncogenic epigenetic signatures A functional link between nuclear RNA decay and transcriptional control mediated by the polycomb repressive complex 2 Metabolic modifier screen reveals secondary targets of protein kinase inhibitors within nucleotide metabolism Generation of complex human organoid models including vascular networks by incorporation of mesodermal progenitor cells Dopamine D2 receptor modulates Wnt expression and control of cell proliferation Bioscaffold-induced brain tissue regeneration Lipid signaling drives proteolytic rewiring of mitochondria by YME1L Incorporation of biomarkers into risk assessment for allocation of antihypertensive medication according to the 2017 ACC/AHA high blood pressure guideline: a pooled cohort analysis Metabolic effects of JAK1/2 inhibition in patients with myeloproliferative neoplasms The long noncoding RNA lncNB1 promotes tumorigenesis by interacting with ribosomal protein RPL35 Integrative transcriptomics reveals sexually dimorphic control of the cholinergic/neurokine interface in schizophrenia and bipolar disorder CD9 identifies pancreatic cancer stem cells and modulates glutamine metabolism to fuel tumor growth Late developing cardiac lymphatic vasculature supports adult zebrafish heart function and regeneration Combined electrostatic and air driven electrospinning for biomedical applications Is running associated with a lower risk of all-cause, cardiovascular and cancer mortality, and is the more the better? A systematic review and meta-analysis Memory retrieval modulates spatial tuning of single neurons in the human entorhinal cortex Transcriptional signature derived from murine tumor-associated macrophages correlates with poor outcome in breast cancer patients Wearable sensors for estimation of Parkinsonian tremor severity during free body movements Loading dependent structural model of polymeric micelles encapsulating curcumin by solid-state NMR spectroscopy Dynorphin‐based “release on demand” gene therapy for drug‐resistant temporal lobe epilepsy Dental epithelial stem cells as a source for mammary gland regeneration and milk producing cells in vivo Non-enzymatic roles of human RAD51 at stalled replication forks A mechanism for increased sensitivity of acute myeloid leukemia to mitotoxic drugs Structure of the RSC complex bound to the nucleosome RhoA controls axon extension independent of specification in the developing brain Broadly protective human antibodies that target the active site of influenza virus neuraminidase PilT and PilU are homohexameric ATPases that coordinate to retract type IVa pili Search-and-replace genome editing without double-strand breaks or donor DNA Association between cardiovascular health and cognitive performance: a twins study Individualized recovery of gut microbial strains post antibiotics Haptoglobin administration into the subarachnoid space prevents hemoglobin-induced cerebral vasospasm Overall mortality after diagnosis of breast cancer in men vs women Peptoid nanotubes: bioinspired peptoid nanotubes for targeted tumor cell imaging and chemo‐photodynamic therapy (small 43/2019) Association of acquired and heritable factors with intergenerational differences in age at symptomatic onset of Alzheimer disease between offspring and parents with dementia Mucin glycans attenuate the virulence of Pseudomonas aeruginosa in infection Regulation of lifespan by neural excitation and REST Fusing randomized trials with big data: the key to self-learning health care systems? Habitual tea drinking modulates brain efficiency: evidence from brain connectivity evaluation Phenolic compounds from coffee by-products modulate adipogenesis-related inflammation, mitochondrial dysfunction, and insulin resistance in adipocytes, via insulin/PI3K/AKT signaling pathways Patient-tailored, connectivity-based forecasts of spreading brain atrophy Multiplexed activation of endogenous genes by CRISPRa elicits potent antitumor immunity TCF-1-centered transcriptional network drives an effector versus exhausted CD8 T cell-fate decision Peripheral blood DNA methylation differences in twin pairs discordant for Alzheimer’s disease Robust prediction of HLA class II epitopes by deep motif deconvolution of immunopeptidomes 1-Deoxydihydroceramide causes anoxic death by impairing chaperonin-mediated protein folding Global impact of somatic structural variation on the DNA methylome of human cancers Analysis of “old” proteins unmasks dynamic gradient of cartilage turnover in human limbs Whole-genome sequencing of triple-negative breast cancers in a population-based clinical study Cardiovascular risk scoring and magnetic resonance imaging detected subclinical cerebrovascular disease Cannabidiol counteracts the psychotropic side-effects of δ-9-tetrahydrocannabinol in the ventral hippocampus through bi-directional control of ERK1-2 phosphorylation Amyloid-beta impairs TOM1-mediated IL-1R1 signaling The use of biologics for the elbow: a critical analysis review The role of biologic agents in the management of common shoulder pathologies: current state and future directions Dietary sugars alter hepatic fatty acid oxidation via transcriptional and post-translational modifications of mitochondrial proteins Global trends in antimicrobial resistance in animals in low- and middle-income countries Structures of the rhodopsin-transducin complex: insights into G-protein activation Ultralow-threshold, continuous-wave upconverting lasing from subwavelength plasmons A triple drug combination targeting components of the nutrient-sensing network maximizes longevity Preclinical performance of a pediatric mechanical circulatory support device: The PediaFlow ventricular assist device Impact of the 2016 revision of US pediatric heart allocation policy on waitlist characteristics and outcomes Control of cytokinesis by β-adrenergic receptors indicates an approach for regulating cardiomyocyte endowment American Society for Bone and Mineral Research‐Orthopaedic Research Society Joint Task Force report on cell‐based therapies Effects of high glucose–induced lysyl oxidase propeptide on retinal endothelial cell survival Fatty liver disease caused by high-alcohol-producing Klebsiella pneumoniae Targeted delivery of CRISPR interference system against Fabp4 to white adipocytes ameliorates obesity, inflammation, hepatic steatosis, and insulin resistance Structural insight into eukaryotic sterol transport through Niemann-Pick type C proteins Ultra-long-acting tunable biodegradable and removable controlled release implants for drug delivery Nilotinib, an approved leukemia drug, inhibits smoothened signaling in Hedgehog-dependent medulloblastoma Impact of the 2016 revision of US pediatric heart allocation policy on waitlist characteristics and outcomes Fungal biofilm morphology impacts hypoxia fitness and disease progression N822K- or V560G-mutated KIT activation preferentially occurs in lipid rafts of the Golgi apparatus in leukemia cells Monitoring the formation of amyloid oligomers using photoluminescence anisotropy A neuroD1 AAV-based gene therapy for functional brain repair after ischemic injury through in vivo astrocyte-to-neuron conversion A cell fitness selection model for neuronal survival during development Machine learning analysis of DNA methylation profiles distinguishes primary lung squamous cell carcinomas from head and neck metastases Discovery and preclinical evaluation of anti-miR-17 oligonucleotide RGLS4326 for the treatment of polycystic kidney disease Distinct initiating events underpin the immune and metabolic heterogeneity of KRAS-mutant lung adenocarcinoma B cells sustain inflammation and predict response to immune checkpoint blockade in human melanoma Microvesicle-mediated delivery of minicircle DNA results in effective gene-directed enzyme prodrug cancer therapy Inhibition of IL-2 responsiveness by IL-6 is required for the generation of GC-Tfh cells Induction of immunological tolerance to myelinogenic glial-restricted progenitor allografts PSEN1ΔE9, APPswe, and APOE4 confer disparate phenotypes in human iPSC-derived microglia Interrogating Parkinson's disease associated redox targets: potential application of CRISPR editing Complex oscillatory waves emerging from cortical organoids model early human brain network development Electronic skin to feel “pain”: detecting “prick” and “hot” pain sensations Comparable rates of integrated myofibrillar protein synthesis between endurance-trained master athletes and untrained older individuals Notch coordinates periodontal ligament maturation through regulating Lamin A. Transplantation of kidneys from hepatitis C–infected donors to hepatitis C–negative recipients: Single center experience Position B57 of I-A controls early anti-insulin responses in NOD mice, linking an MHC susceptibility allele to type 1 diabetes onset Single-cell transcriptomics reveals multi-step adaptations to endocrine therapy OmpK36-mediated Carbapenem resistance attenuates ST258 Klebsiella pneumoniae in vivo A library of human gut bacterial isolates paired with longitudinal multiomics data enables mechanistic microbiome research A cell-penetrating scorpion toxin enables mode-specific modulation of TRPA1 and pain MDSC targeting with Gemtuzumab ozogamicin restores T cell immunity and immunotherapy against cancers MiR322 mediates cardioprotection against ischemia/reperfusion injury via FBXW7/notch pathway Immuno-subtyping of breast cancer reveals distinct myeloid cell profiles and immunotherapy resistance mechanisms Endothelial TGF-β signalling drives vascular inflammation and atherosclerosis Mechanical stabilization of the glandular acinus by linker of nucleoskeleton and cytoskeleton complex Chemoptogenetic damage to mitochondria causes rapid telomere dysfunction A mechanism for statin-induced susceptibility to myopathy Nab-paclitaxel: a new standard of care in neoadjuvant therapy of high-risk early breast cancer? Gold nanoshell-localized photothermal ablation of prostate tumors in a clinical pilot device study Structure, function, and ion-binding properties of a K+ channel stabilized in the 2,4-ion–bound configuration Organ-on-e-chip: Three-dimensional self-rolled biosensor array for electrical interrogations of human electrogenic spheroids Optimization of silicone 3d printing with hierarchical machine learning Longitudinal neurometabolic changes in the hippocampus of a rat model of chronic hepatic encephalopathy Pro-survival lipid sphingosine-1-phosphate metabolically programs T cells to limit anti-tumor activity Abemaciclib is effective against pancreatic cancer cells and synergizes with HuR and YAP1 inhibition MEK inhibition modulates cytokine response to mediate therapeutic efficacy in lung cancer Remote post-ischemic conditioning promotes stroke recovery by shifting circulating monocytes to CCR2+ pro-inflammatory subset Energy‐mediated machinery drives cellular mechanical allostasis Genetic liability to insomnia and cardiovascular disease risk Interaction of α carboxyl terminus 1 peptide with the connexin 43 carboxyl terminus preserves left ventricular function after ischemia‐reperfusion injury Spatially selective activation of the visual cortex via intraneural stimulation of the optic nerve Downgrading of regulation in regenerative medicine Adenosine kinase inhibition augments conducted vasodilation and prevents left ventricle diastolic dysfunction in heart failure with preserved ejection fraction Mutations in RABL3 alter KRAS prenylation and are associated with hereditary pancreatic cancer A robotic neck brace to characterize head‐neck motion and muscle electromyography in subjects with amyotrophic lateral sclerosis Molecular structure of an N-terminal phosphorylated β-amyloid fibril A glomerulus-on-a-chip to recapitulate the human glomerular filtration barrier Neuronal BC RNA transport impairments caused by systemic lupus erythematosus autoantibodies In vivo restoration of myocardial conduction with carbon nanotube fibers A counter gradient of Activin A and follistatin instructs the timing of hair cell differentiation in the murine cochlea Wireless optofluidic brain probes for chronic neuropharmacology and photostimulation Spontaneous isomerization of long-lived proteins provides a molecular mechanism for the lysosomal failure observed in Alzheimer’s disease Development of a clinically relevant chemoresistant mantle cell lymphoma cell culture model Long-term host immune response trajectories among hospitalized patients with sepsis Generation of human fatty livers using custom-engineered induced pluripotent stem cells with modifiable SIRT1 metabolism High-dose spironolactone when patients with acute decompensated heart failure are resistant to loop diuretics: a pilot study Metal oxide semiconductor nanomembrane–based soft unnoticeable multifunctional electronics for wearable human-machine interfaces Modeling steatohepatitis in humans with pluripotent stem cell-derived organoids Meta-weighted gaussian process experts for personalized forecasting of AD cognitive changes An artificial intelligence-enabled ECG algorithm for the identification of patients with atrial fibrillation during sinus rhythm: a retrospective analysis of outcome prediction Structural redundancy in supracellular actomyosin networks enables robust tissue folding Repressive gene regulation synchronizes development with cellular metabolism Exosomes containing HIV protein Nef reorganize lipid rafts potentiating inflammatory response in bystander cells Inhibition of nucleotide synthesis promotes replicative senescence of human mammary epithelial cells Single cell analysis of human foetal liver captures the transcriptional profile of hepatobiliary hybrid progenitors 3D bioprinting of collagen to rebuild components of the human heart The AMPK-related kinases SIK1 and SIK3 mediate key tumor suppressive effects of LKB1 in NSCLC RPS25 is required for efficient RAN translation of C9orf72 and other neurodegenerative disease-associated nucleotide repeats Atheroprotective roles of smooth muscle cell phenotypic modulation and the TCF21 disease gene as revealed by single-cell analysis Biomimetic sensory feedback through peripheral nerve stimulation improves dexterous use of a bionic hand Modular and tunable biological feedback control using a de novo protein switch De novo design of bioactive protein switches AEBP1 expression increases with severity of fibrosis in NASH and is regulated by glucose, palmitate, and miR-372-3p Canine osteosarcoma genome sequencing identifies recurrent mutations in DMD and the histone methyltransferase gene SETD2 Adenylyl cyclase 5–generated cAMP controls cerebral vascular reactivity during diabetic hyperglycemia Predicting bacterial infection outcomes using single cell RNA-sequencing analysis of human immune cells Noncoding CGG repeat expansions in neuronal intranuclear inclusion disease, oculopharyngodistal myopathy and an overlapping disease A case report of clonal EBV-like memory CD4 T cell activation in fatal checkpoint inhibitor-induced encephalitis Targeting seizure-induced neurogenesis in a clinically relevant time-period leads to transient but not persistent seizure reduction Potential roles of gut microbiome and metabolites in modulating ALS in mice Optogenomic interfaces: bridging biological networks with the electronic digital world Persistent gamma spiking in SI nonsensory fast spiking cells predicts perceptual success Damage sensor role of UV-DDB during base excision repair Association between state-mandated protocolized sepsis care and in-hospital mortality among adults with sepsis Adult living donor versus deceased donor liver transplant (LDLT Versus DDLT) at a single center. Time to change our paradigm for liver transplant Using a continuum model to decipher the mechanics of embryonic tissue spreading from time-lapse image sequences: An approximate Bayesian computation approach Enhanced CAR–T cell activity against solid tumors by vaccine boosting through the chimeric receptor Targeting IDH1 as a prosenescent therapy in high-grade serous ovarian cancer Forward genetic screen for Caenorhabditis elegans mutants with a shortened locomotor healthspan Biocide resistance and transmission of Clostridium difficile spores spiked onto clinical surfaces from an American healthcare facility Electrocardiomatrix facilitates accurate detection of atrial fibrillation in stroke patients Protein interaction networks revealed by proteome coevolution Sheath-run artificial muscles Structure and mechanism of pyrimidine–pyrimidone (6-4) photoproduct recognition by the Rad4/XPC nucleotide excision repair complex DNA translocation mechanism of the MCM complex and implications for replication initiation Nerve injury drives a heightened state of vigilance and neuropathic sensitization in Drosophila Targeting a ceramide double bond improves insulin resistance and hepatic steatosis Single-cell analysis reveals T cell infiltration in old neurogenic niches Designer artificial membrane binding proteins to direct stem cells to the myocardium Inhibition of HER2-positive breast cancer growth by blocking the HER2 signaling pathway with HER2-glycan-imprinted nanoparticles Crystal structure of the mitochondrial protein mitoNEET bound to a benze-sulfonide ligand An ultrafast system for signaling mechanical pain in human skin Myelinating Schwann cells ensheath multiple axons in the absence of E3 ligase component Fbxw7 National and state estimates of lost earnings from cancer deaths in the United States Self-organized synchronous calcium transients in a cultured human neural network derived from cerebral organoids Sequential LASER ART and CRISPR treatments eliminate HIV-1 in a subset of infected humanized mice Targeting a ceramide double bond improves insulin resistance and hepatic steatosis Single-cell analysis reveals T cell infiltration in old neurogenic niches Designer artificial membrane binding proteins to direct stem cells to the myocardium Inhibition of HER2-positive breast cancer growth by blocking the HER2 signaling pathway with HER2-glycan-imprinted nanoparticles Crystal structure of the mitochondrial protein mitoNEET bound to a benze-sulfonide ligand An ultrafast system for signaling mechanical pain in human skin Myelinating Schwann cells ensheath multiple axons in the absence of E3 ligase component Fbxw7 National and state estimates of lost earnings from cancer deaths in the United States Self-organized synchronous calcium transients in a cultured human neural network derived from cerebral organoids Sequential LASER ART and CRISPR treatments eliminate HIV-1 in a subset of infected humanized mice Nrf2 activation promotes lung cancer metastasis by inhibiting the degradation of Bach1 BACH1 stabilization by antioxidants stimulates lung cancer metastasis Human intestinal enteroids with inducible neurogenin-3 expression as a novel model of gut hormone secretion Structure of the Cdc48 segregase in the act of unfolding an authentic substrate LC3-associated endocytosis facilitates β-amyloid clearance and mitigates neurodegeneration in murine Alzheimer’s disease The x-linked DDX3X RNA helicase dictates translation reprogramming and metastasis in melanoma Infection as a stroke trigger SGEF forms a complex with Scribble and Dlg1 and regulates epithelial junctions and contractility Engineered signaling centers for the spatially controlled patterning of human pluripotent stem cells Noninvasive neuroimaging enhances continuous neural tracking for robotic device control Microbiota therapy acts via a regulatory T cell MyD88/RORγt pathway to suppress food allergy De novo lung biofabrication: clinical need, construction methods, and design strategy Patterns of opioid administration among opioid-naive inpatients and associations with postdischarge opioid use: a cohort study Vitamin K status and mobility limitation and disability in older adults: the health, aging, and body composition study Comparative “virtual biopsies” of normal skin and skin lesions using vibrational optical coherence tomography Cartilage binding antibodies induce pain through immune complex mediated activation of neurons Improved outcomes after autologous hematopoietic cell transplantation for light chain amyloidosis: a Center for International Blood and Marrow Transplant Research study Viral capsid trafficking along treadmilling tubulin filaments in bacteria Sporadic Creutzfeldt-Jakob disease prion infection of human cerebral organoids Long-duration hippocampal sharp wave ripples improve memory Discovery and inhibition of an interspecies gut bacterial pathway for Levodopa metabolism Identifying brain tumors by differential mobility spectrometry analysis of diathermy smoke Stabilization of the cardiac sarcolemma by sarcospan rescues DMD-associated cardiomyopathy Preimplant phosphodiesterase-5 inhibitor use is associated with higher rates of severe early right heart failure after left ventricular assist device implantation: an INTERMACS analysis. Spatiotemporal structure of cell fate decisions in murine neural crest Mitochondrial dysfunction causes Ca2 overload and ECM degradation–mediated muscle damage in C. elegans Single-cell transcriptomics unveils gene regulatory network plasticity Pre-existing commensal dysbiosis is a host-intrinsic regulator of tissue inflammation and tumor cell dissemination in hormone receptor-positive breast cancer Cooperation between constitutive and inducible chemokines enables T cell engraftment and immune attack in solid tumors Tau binding protein CAPON induces tau aggregation and neurodegeneration Age mosaicism across multiple scales in adult tissues Cell-based therapy restores olfactory function in an inducible model of hyposmia Tissue-engineering the intestine: the trials before the trials Establishment of porcine and human expanded potential stem cells New neural activity patterns emerge with long-term learning Fatty acid transport protein 2 reprograms neutrophils in cancer Association of net ultrafiltration rate with mortality among critically ill adults with AKI receiving continuous venovenous hemodiafiltration… Propagation and selectivity of axonal loss in Leber hereditary optic neuropathy Differentiation of mild cognitive impairment using an entorhinal cortex-based test of virtual reality navigation Membralin deficiency dysregulates astrocytic glutamate homeostasis leading to ALS-like impairment The cell-wide web coordinates cellular processes by directing site-specific Ca2 flux across cytoplasmic nanocourses Translation affects mRNA stability in a codon-dependent manner in human cells A randomized trial evaluating bioimpedance spectroscopy versus tape measurement for the prevention of lymphedema following treatment for breast cancer: interim analysis Stem cell-associated heterogeneity in Glioblastoma results from intrinsic tumor plasticity shaped by the microenvironment Targeted homology-directed repair in blood stem and progenitor cells with CRISPR nanoformulations The viral protein corona directs viral pathogenesis and amyloid aggregation Artificially enhancing and suppressing hippocampus-mediated memories Solution processable liquid metal nanodroplets by surface-initiated atom transfer radical polymerization Reward-driven changes in striatal pathway competition shape evidence evaluation in decision-making Electric field based dressing disrupts mixed-species bacterial biofilm infection and restores functional wound healing Egg consumption, cholesterol intake, and risk of incident stroke in men: the Kuopio Ischaemic Heart Disease Risk Factor Study BRD4 regulates metastatic potential of castration-resistant prostate cancer through AHNAK Epigenetic dysregulation of enhancers in neurons is associated with Alzheimer’s disease pathology and cognitive symptoms Light entrains diurnal changes in insulin sensitivity of skeletal muscle via ventromedial hypothalamic neurons Bioactive site-specifically modified proteins for 4D patterning of gel biomaterials Charting cellular identity during human in vitro β-cell differentiation Insufficient sleep is associated with a pro‐atherogenic circulating microRNA signature Coordinated conformational processing of the tumor suppressor protein p53 by the Hsp70 and Hsp90 chaperone machineries Reactivation of PTEN tumor suppressor for cancer treatment through inhibition of a MYC-WWP1 inhibitory pathway Treatment of volumetric muscle loss in mice using nanofibrillar scaffolds enhances vascular organization and integration Early neuromuscular blockade in the acute respiratory distress syndrome Derivation, validation, and potential treatment implications of novel clinical phenotypes for sepsis Targeted and persistent 8-oxoguanine base damage at telomeres promotes telomere loss and crisis Expression of endogenous retroviruses reflects increased usage of atypical enhancers in T cells Autocrine LTA signaling drives NF-κB and JAK-STAT activity and myeloid gene expression in Hodgkin lymphoma Dual inhibition of glutaminase and carnitine palmitoyltransferase decreases growth and migration of glutaminase inhibition–resistant triple-negative breast cancer cells Prospective comprehensive genomic profiling of primary and metastatic prostate tumors ‘Non-self’ Mutation: Double-stranded RNA elicits antiviral pathogenic response in a Drosophila model of expanded CAG repeat neurodegenerative diseases Aβ oligomer elimination restores cognition in transgenic Alzheimer’s mice with full-blown pathology Osteoblasts are “educated” by crosstalk with metastatic breast cancer cells in the bone tumor microenvironment Rare protein-truncating variants in APOB, lower LDL-C, and protection against coronary heart disease A complex human gut microbiome cultured in an anaerobic intestine-on-a-chip Rapid invariant encoding of scene layout in human OPA A prospective, single-arm, multicenter trial of catheter-directed mechanical thrombectomy for intermediate-risk acute pulmonary embolism--the FLARE study A high-throughput platform to identify small-molecule inhibitors of CRISPR-Cas9 Balance of mechanical forces drives endothelial gap formation and may facilitate cancer and immune-cell extravasation Neural population control via deep image synthesis Human salivary amylase gene copy number impacts oral and gut microbiomes Optogenetic control shows that kinetic proofreading regulates the activity of the T cell receptor Deficient endoplasmic reticulum-mitochondrial phosphatidylserine transfer causes liver disease Inhibition of MYC by the SMARCB1 tumor suppressor Chromatin three-dimensional interactions mediate genetic effects on gene expression Direct induction of the three pre-implantation blastocyst cell types from fibroblasts A compact synthetic pathway rewires cancer signaling to therapeutic effector release Pericyte transplantation improves skeletal muscle recovery following hindlimb immobilization Neural control of body-plan axis in regenerating planaria A niche-dependent myeloid transcriptome signature defines dormant myeloma cells Lung cancer in never-smokers: a hidden disease TET enzymes augment AID expression via 5hmC modifications 1 at the Aicda superenhancer Cross-sectional study of HPV testing in self-sampled urine and comparison with matched vaginal and cervical samples in women attending colposcopy for the management of abnormal cervical screening A nanoelectronics-blood-based diagnostic biomarker for myalgic encephalomyelitis/chronic fatigue syndrome (ME/CFS) Why does Clostridium difficile infection recur? Catalytic antimicrobial robots for biofilm eradication An integrated microfluidic flow-focusing platform for on-chip fabrication and filtration of cell-laden microgels Collaboration and competition between active sheets for self-propelled particles Cost-effectiveness of the US Food and Drug Administration added sugar labeling policy for improving diet and health TRIM9-mediated resolution of neuroinflammation confers neuroprotection upon ischemic stroke in mice Defining UHRF1 domains that support maintenance of human colon cancer DNA methylation and oncogenic properties A single-cell atlas of the tumor and immune ecosystem of human breast cancer CRISPR-suppressor scanning reveals a nonenzymatic role of LSD1 in AML A novel, widespread qacA allele results in reduced chlorhexidine susceptibility in Staphylococcus epidermidis Clinical credence — SGLT2 inhibitors, diabetes, and chronic kidney disease Architecture and subunit arrangement of native AMPA receptors elucidated by cryo-EM Working memory revived in older adults by synchronizing rhythmic brain circuits 3D printing of personalized thick and perfusable cardiac patches and hearts Association of closed-loop brain stimulation neurophysiological features with seizure control among patients with focal epilepsy Quiescence modulates stem cell maintenance and regenerative capacity in the aging brain Systemic clinical tumor regressions and potentiation of PD1 blockade with in situ vaccination Biomarkers for closed-loop deep brain stimulation in Parkinson disease and beyond Diagnostic and prognostic potential of AKR1B10 in human hepatocellular carcinoma The antiangiogenic activity of naturally occurring and synthetic homoisoflavonoids from the Hyacinthaceae (sensu APGII) Immunization with components of the viral fusion apparatus elicits antibodies that neutralize Epstein-Barr virus in B cells and epithelial cells Single-cell transcriptomics of human and mouse lung cancers reveals conserved myeloid populations across individuals and species Outcomes after proton therapy for treatment of pediatric high-risk neuroblastoma Genetic testing and results in a population-based cohort of breast cancer patients and ovarian cancer patients cisTopic: cis-regulatory topic modeling on single-cell ATAC-seq data Patient behaviors and characteristics related to weight regain after Roux-en-Y gastric bypass: a multicenter prospective cohort study The emerging relationship between regenerative medicine and physical therapeutics GRASP55 and UPR control interleukin-1β aggregation and secretion MYC recruits SPT5 to RNA polymerase II to promote processive transcription elongation Association of in vitro fertilization with childhood cancer in the United States Skin-inspired, open mesh electrochemical sensors for lactate and oxygen monitoring Gut microbiota dependent anti-tumor immunity restricts melanoma growth in Rnf5−/− mice Ultrasensitive hyperspectral imaging and biodetection enabled by dielectric metasurfaces Tendinosis develops from age‐ and oxygen tension‐dependent modulation of Rac1 activity Meta-analysis of fecal metagenomes reveals global microbial signatures that are specific for colorectal cancer Prediction of premature all-cause mortality: A prospective general population cohort study comparing machine-learning and standard epidemiological approaches A common embryonic origin of stem cells drives developmental and adult neurogenesis Adaptive plasticity of IL-10+ and IL-35+ Treg cells cooperatively promotes tumor T cell exhaustion p190RhoGAP filters competing signals to resolve axon guidance conflicts Ptpn21 controls hematopoietic stem cell homeostasis and biomechanics The TNF-derived TIP peptide activates the epithelial sodium channel and ameliorates experimental nephrotoxic serum nephritis Stimuli-responsive injectable cellulose thixogel for cell encapsulation Cell-free gene-regulatory network engineering with synthetic transcription factors Proposed percutaneous aortic valve prosthesis made of cryogel L-sepiapterin restores SLE serum-induced markers of endothelial function in endothelial cells Genome-wide association meta-analysis of functional outcome after ischemic stroke Targeting senescent cells alleviates obesity‐induced metabolic dysfunction High-fructose corn syrup enhances intestinal tumor growth in mice Total pancreatectomy with islet autologous transplantation: the cure for chronic pancreatitis? Total pancreatectomy and islet autotransplantation in chronic pancreatitis: recommendations from PancreasFest Novel insights from uncultivated genomes of the global human gut microbiome Oscillations of MyoD and Hes1 proteins regulate the maintenance of activated muscle stem cells Effects of icosapent ethyl on total ischemic events: from REDUCE-IT A nuclear phosphoinositide kinase complex regulates p53 Role of human ventromedial prefrontal cortex in learning and recall of enhanced extinction GARP dampens cancer immunity by sustaining function and accumulation of regulatory T cells in the colon Biomaterials-aided mandibular reconstruction using in vivo bioreactors Infection drives long-term meningeal engraftment by inflammatory monocytes that impair central nervous system immunity Using a deep learning algorithm and integrated gradients explanation to assist grading for diabetic retinopathy Restoration of high-sensitivity and adapting vision with a cone opsin Intrahepatic fibrin(ogen) deposition drives liver regeneration after partial hepatectomy in mice and humans HLA-A*32:01 is strongly associated with vancomycin-induced drug reaction with eosinophilia and systemic symptoms PARP inhibition enhances tumor cell–intrinsic immunity in ERCC1-deficient non–small cell lung cancer Associations between vascular risk factors and brain MRI indices in UK Biobank Retinal microvascular and neurodegenerative changes in Alzheimer’s disease and mild cognitive impairment compared with control participants 68Ga-FAPI PET/CT: Biodistribution and Preliminary Dosimetry Estimate of 2 DOTA-Containing FAP-Targeting Agents in Patients with Various Cancers Pan-cancer association of a centrosome amplification gene expression signature with genomic alterations and clinical outcome Successful genetic transfection of the colonic protistan parasite blastocystis for reliable expression of ectopic genes Interactions between a pathogenic Blastocystis subtype and gut microbiota: in vitro and in vivo studies Label-free Raman spectroscopy reveals signatures of radiation resistance in the tumor microenvironment Association of muscular strength and incidence of type 2 diabetes Fabrication of 3D-nanofibrous fibrinogen scaffolds using salt-induced self-assembly ACVR1 R206H cooperates with H3.1K27M in promoting diffuse intrinsic pontine glioma pathogenesis Foxg1 antagonizes neocortical stem cell progression to astrogenesis Impact of sarcopenia in patients with advanced non–small cell lung cancer treated with PD-1 inhibitors: A preliminary retrospective study Tapered InP nanowire arrays for efficient broadband high-speed single-photon detection Fibroblasts activation and abnormal extracellular matrix remodelling as common hallmarks in three cancer-prone genodermatoses Identification of PKD1L1 gene variants in children with the biliary atresia splenic malformation syndrome Tubuloids derived from human adult kidney and urine for personalized disease modeling Protective autophagy elicited by RAF→MEK→ERK inhibition suggests a treatment strategy for RAS-driven cancers RNA binding antagonizes neurotoxic phase transitions of TDP-43 Real-time targeted genome profile analysis of pancreatic ductal adenocarcinomas identifies genetic alterations that might be targeted with existing drugs or used as biomarkers The Society of Thoracic Surgeons Intermacs database annual report: Evolving indications, outcomes, and scientific partnerships Transplanting hepatitis C virus‐infected hearts into uninfected recipients: A single‐arm trial The ATP-binding cassette gene ABCF1 functions as an E2 ubiquitin-conjugating enzyme controlling macrophage polarization to dampen lethal septic shock Structure of Calcarisporiella thermophila Hsp104 disaggregase that antagonizes diverse proteotoxic misfolding events H4K20me0 recognition by BRCA1–BARD1 directs homologous recombination to sister chromatids Bisulfite-free direct detection of 5-methylcytosine and 5-hydroxymethylcytosine at base resolution Intracellular bacteria engage a STING–TBK1–MVB12b pathway to enable paracrine cGAS–STING signalling Isolation of circulating tumor cells in non-small-cell-lung-cancer patients using a multi-flow microfluidic channel Osteoporosis and skeletal dysplasia caused by pathogenic variants in SGMS2 Cognitive and physical activity and dementia A neuron-optimized CRISPR/dCas9 activation system for robust and specific gene regulation Young bone marrow transplantation preserves learning and memory in old mice Concentric organization of A- and B-type lamins predicts their distinct roles in the spatial organization and stability of the nuclear lamina The role of astrocytes in seizure generation: insights from a novel in vitro seizure model based on mitochondrial dysfunction Neurons with complex karyotypes are rare in aged human neocortex Small molecule nicotinamide N-methyltransferase inhibitor activates senescent muscle stem cells and improves regenerative capacity of aged skeletal muscle Avelumab plus Axitinib versus Sunitinib for advanced renal-cell carcinoma Integrated analysis of population genomics, transcriptomics and virulence provides novel insights into Streptococcus pyogenes pathogenesis Long-term evaluation of AAV-CRISPR genome editing for Duchenne muscular dystrophy Fibroblasts and alectinib switch the evolutionary games played by non-small cell lung cancer Gene-by-sex interactions in mitochondrial functions and cardio-metabolic traits A novel combinatorial technique for simultaneous quantification of oxygen radicals and aggregation reveals unexpected redox patterns in the activation of platelets by different physiopathological stimuli Diabetes relief in mice by glucose-sensing insulin-secreting human alpha-cells Intracortical neural stimulation with untethered, ultrasmall carbon fiber electrodes mediated by the photoelectric effect Obstructive sleep apnea and inflammation: proof of concept based on two illustrative cytokines eIF5A inhibition influences T cell dynamics in the pancreatic microenvironment of the humanized mouse model of Type 1 Diabetes Measles vector as a multiple genes delivery platform facilitating iPSC reprogramming Hearing impairment and cognitive decline in older, community-dwelling adults Inflammation, necrosis, and the kinase RIP3 are key mediators of AAG-dependent alkylation-induced retinal degeneration Species-specific maturation profiles of human, chimpanzee and bonobo neural cells Dynamically stiffened matrix promotes malignant transformation of mammary epithelial cells via collective mechanical signaling Satb1 regulates the effector program of encephalitogenic tissue Th17 cells in chronic inflammation Estrogen improves insulin sensitivity and suppresses gluconeogenesis via the transcription factor Foxo1 CEBPA-mutated leukemia is sensitive to genetic and pharmacological targeting of the MLL1 complex A human gut bacterial genome and culture collection for improved metagenomic analyses SMARCA4 loss is synthetic lethal with CDK4/6 inhibition in non-small cell lung cancer CDK4/6 inhibitors target SMARCA4-determined cyclin D1 deficiency in hypercalcemic small cell carcinoma of the ovary Predictors of symptomatic kidney stone recurrence after the first and subsequent episodes Codon stabilization coefficient as a metric to gain insights into mRNA stability and codon bias and their relationships with translation HIV-1 Vpu is a potent transcriptional suppressor of NF-κB-elicited antiviral immune responses Physical activity of UK adults with chronic disease: cross-sectional analysis of accelerometer-measured physical activity in 96,706 UK Biobank participants Patterned human microvascular grafts enable rapid vascularization and increase perfusion in infarcted rat hearts Single-cell profiling identifies myeloid cell subsets with distinct fates during neuroinflammation Wild-type p53 promotes cancer metabolic switch by inducing PUMA-dependent suppression of oxidative phosphorylation Energy harvesting: flexible porous piezoelectric cantilever on a pacemaker lead for compact energy harvesting Inhibiting glutamine-dependent mTORC1 activation ameliorates liver cancers driven by β-catenin mutations Safety, tolerability, pharmacokinetics, and immunogenicity of the therapeutic monoclonal antibody mAb114 targeting Ebola virus glycoprotein (VRC 608): an open-label phase 1 study NFIL3 mutations alter immune homeostasis and sensitise for arthritis pathology Astrocytes regulate the development and maturation of retinal ganglion cells derived from human pluripotent stem cells Skeletal muscles do not undergo apoptosis during either atrophy or programmed cell death-revisiting the myonuclear domain hypothesis The endoplasmic reticulum chaperone glucose-regulated protein 94 is essential for proinsulin handling Targeting Sirt-1 controls GVHD by inhibiting T-cell allo-response and promoting Treg stability in mice Spectral contrast optical coherence tomography angiography enables single-scan vessel imaging Allogeneic ex vivo expanded corneal epithelial stem cell transplantation: a randomized controlled clinical trial EZH2 oncogenic mutations drive epigenetic, transcriptional, and structural changes within chromatin domains Cholecystokinin and Alzheimer’s disease: a biomarker of metabolic function, neural integrity, and cognitive performance Timed GDNF gene therapy using an immune-evasive gene switch promotes long distance axon regeneration COL6A3-derived endotrophin links reciprocal interactions among hepatic cells in the pathology of chronic liver disease Functional synaptic architecture of callosal inputs in mouse primary visual cortex Microvascular endothelial cells engulf myelin debris and promote macrophage recruitment and fibrosis after neural injury Structural elements of a pH-sensitive inhibitor binding site in NMDA receptors Identification of new therapeutic targets for osteoarthritis through genome-wide analyses of UK Biobank data Metabolic rewiring of macrophages by CpG potentiates clearance of cancer cells and overcomes tumor-expressed CD47−mediated ‘don’t-eat-me’ signal Basophil-derived tumor necrosis factor can enhance survival in a sepsis model in mice Endosomolytic polymersomes increase the activity of cyclic dinucleotide STING agonists to enhance cancer immunotherapy Serum neurofilament dynamics predicts neurodegeneration and clinical progression in presymptomatic Alzheimer's Disease Estrogen signaling in arcuate Kiss1 neurons suppresses a sex-dependent female circuit promoting dense strong bones High Rac1 activity is functionally translated into cytosolic structures with unique nanoscale cytoskeletal architecture Comparison of immune infiltrates in melanoma and pancreatic cancer highlights VISTA as a potential target in pancreatic cancer Cell number in mesenchymal stem cell aggregates dictates cell stiffness and chondrogenesis Disruption of coronin 1 signaling in T Cells promotes allograft tolerance while maintaining anti-pathogen immunity Intergenerational inheritance of high fat diet-induced cardiac lipotoxicity in Drosophila 3K3A-activated protein C blocks amyloidogenic BACE1 pathway and improves functional outcome in mice An interferon-driven oxysterol-based defense against tumor-derived extracellular vesicles Genetic liver-specific AMPK activation protects against diet-induced obesity and NAFLD Synapse-selective control of cortical maturation and plasticity by Parvalbumin-autonomous action of SynCAM 1 Pancreatic islet-autonomous insulin and smoothened-mediated signalling modulate identity changes of glucagon α-cells WISP-1 drives bone formation at the expense of fat formation in human perivascular stem cells Senolytics in idiopathic pulmonary fibrosis: results from a first-in-human, open-label, pilot study Lactosylceramide synthase β-1,4-GalT-V: A novel target for the diagnosis and therapy of human colorectal cancer Maternal choline supplementation ameliorates Alzheimer’s disease pathology by reducing brain homocysteine levels across multiple generations Antigen-specific TCR signatures of cytomegalovirus infection Arginine citrullination at the C-terminal domain controls RNA polymerase II transcription A collicular visual cortex: Neocortical space for an ancient midbrain visual structure Inhaled nanoformulated mRNA polyplexes for protein production in lung epithelium Biologically inspired, cell‐selective release of aptamer‐trapped growth factors by traction forces Calcium activation of cortical neurons by continuous electrical stimulation: Frequency dependence, temporal fidelity, and activation density Designing self-propelled, chemically active sheets: Wrappers, flappers, and creepers Identification of genes required for eye development by high-throughput screening of mouse knockouts Disruption of the interaction of RAS with PI 3-kinase induces regression of EGFR-mutant-driven lung cancer Harnessing genetic complexity to enhance translatability of Alzheimer’s disease mouse models: a path toward precision medicine A novel alkaliphilic streptomyces inhibits ESKAPE pathogens Identifying cis elements for spatiotemporal control of mammalian DNA replication Targeted muscle reinnervation technique in below-knee amputation A novel form of JARID2 is required for differentiation in lineage‐committed cells Parity and risk of maternal cardiovascular disease: A dose–response meta-analysis of cohort studies Effects of a hydrophilic/hydrophobic interface on amyloid-β peptides studied by molecular dynamics simulations and NMR experiments Effective wound healing enabled by discrete alternative electric fields from wearable nanogenerators Mitochondria modulate programmed neuritic retraction Defective respiration and one-carbon metabolism contribute to impaired naïve T cell activation in aged mice Integrative functional genomic analysis of human brain development and neuropsychiatric risks Geographic disparities in lung transplant rates A tau homeostasis signature is linked with the cellular and regional vulnerability of excitatory neurons to tau pathology Portraits of communication in neuronal networks Tryptophan 32 mediates SOD1 toxicity in a in vivo motor neuron model of ALS and is a promising target for small molecule therapeutics TAC-seq: targeted DNA and RNA sequencing for precise biomarker molecule counting Commensals suppress intestinal epithelial cell retinoic acid synthesis to regulate interleukin-22 activity and prevent microbial dysbiosis A host-produced quorum-sensing autoinducer controls a phage lysis-lysogeny decision Identifying the pathways required for coping behaviours associated with sustained pain HIPPO signaling resolves embryonic cell fate conflicts during establishment of pluripotency in vivo Integrating chemical and mechanical signals through dynamic coupling between cellular protrusions and pulsed ERK activation Quantifying single-cell secretion in real time using resonant hyperspectral imaging Importin α5 regulates anxiety through MeCP2 and Sphingosine Kinase 1 Jamming of deformable polygons Relationships between indicators of cardiovascular disease and intensity of oil and natural gas activity in northeastern Colorado Multivariate computational analysis of gamma delta T cell inhibitory receptor signatures reveals the divergence of healthy and ART-suppressed HIV aging Tau monomer encodes strains Dual inhibition of the lactate transporters MCT1 and MCT4 is synthetic lethal with metformin due to NAD depletion in cancer cells Livebirth after uterus transplantation from a deceased donor in a recipient with uterine infertility Ingestion of subthreshold doses of environmental toxins induces ascending Parkinsonism in the rat Mycoplasma promotes malignant transformation in vivo, and its DnaK, a bacterial chaperon protein, has broad oncogenic properties Cartilage-penetrating nanocarriers improve delivery and efficacy of growth factor treatment of osteoarthritis Active wrinkles to drive self-cleaning: A strategy for anti-thrombotic surfaces for vascular grafts Topography-driven surface renewal Age-related declines in α-Klotho drive progenitor cell mitochondrial dysfunction and impaired muscle regeneration Tamoxifen prolongs survival and alleviates symptoms in mice with fatal X-linked myotubular myopathy Assembly of a pan-genome from deep sequencing of 910 humans of African descent Prion seeds distribute throughout the eyes of sporadic Creutzfeldt-Jakob disease patients Injectable macroporous hydrogel formed by enzymatic cross-linking of gelatin microgels Self-implantable double-layered micro-drug-reservoirs for efficient and controlled ocular drug delivery Large-scale preparation of extracellular vesicles enriched with specific microRNA Alginate-graphene oxide hydrogels with enhanced ionic tunability and chemomechanical stability for light-directed 3D printing Strain-triggered mechanical feedback in self-organizing optic-cup morphogenesis The fibrinolytic factor tPA drives LRP1-mediated melanoma growth and metastasis Convective forces increase CXCR4-dependent glioblastoma cell invasion in GL261 murine model Genetic analysis reveals AMPK is required to support tumor growth in murine kras-dependent lung cancer models DNA origami nanostructures can exhibit preferential renal uptake and alleviate acute kidney injury Dissociation between urate and blood pressure in mice and in people with early Parkinson's disease Oestrogen receptor α AF-1 and AF-2 domains have cell population-specific functions in the mammary epithelium LncRNA HOTAIR regulates lipopolysaccharide-induced cytokine expression and inflammatory response in macrophages Spatiotemporal regulation of the GPCR activity of BAI3 by C1qL4 and Stabilin-2 controls myoblast fusion Pneumolysin binds to the mannose receptor C type 1 (MRC-1) leading to anti-inflammatory responses and enhanced pneumococcal survival Inhibition of amino acid metabolism selectively targets human leukemia stem cells Shape selective bifacial recognition of double helical DNA Organophosphate exposures during pregnancy and child neurodevelopment: Recommendations for essential policy reforms Association of obesity subtypes in the longitudinal assessment of bariatric surgery study and 3‐year postoperative weight change Statins attenuate outgrowth of breast cancer metastases Magnetocardiography on an isolated animal heart with a room-temperature optically pumped magnetometer Mutational landscape of secondary glioblastoma guides MET-targeted trial in brain tumor Variation in TMEM106B in chronic traumatic encephalopathy A biodegradable hybrid inorganic nanoscaffold for advanced stem cell therapy Antifibrotic synergy between phosphodiesterase type 5 inhibitors and selective oestrogen receptor modulators in Peyronie's Disease models Partial loss of psychiatric risk gene Mir137 in mice causes repetitive behavior and impairs sociability and learning via increased Pde10a Evaluating the evidence on sitting, smoking, and health: is sitting really the new smoking? A chemoselective strategy for late-stage functionalization of complex small molecules with polypeptides and proteins Inflammasome inhibition prevents α-synuclein pathology and dopaminergic neurodegeneration in mice Detailed visual cortical responses generated by retinal sheet transplants in rats with severe retinal degeneration The Artificial Intelligence Clinician learns optimal treatment strategies for sepsis in intensive care Wireless resonant circuits for the minimally invasive sensing of biophysical processes in magnetic resonance imaging A histone acetylome-wide association study of Alzheimer’s disease identifies disease-associated H3K27ac differences in the entorhinal cortex Pancreatic islet-autonomous insulin and smoothened-mediated signalling modulate identity changes of glucagon α-cells MUC5B promoter variant and rheumatoid arthritis with interstitial lung disease Antiphospholipid antibodies in patients with myocardial infarction Gut microbiota in the first 2 years of life and the association with body mass index at age 12 in a Norwegian birth cohort BacCapSeq: a platform for diagnosis and characterization of bacterial infections A microfabricated nerve-on-a-chip platform for rapid assessment of neural conduction in explanted peripheral nerve fibers Reticular adhesions are a distinct class of cell-matrix adhesions that mediate attachment during mitosis Programmed assembly of synthetic protocells into thermoresponsive prototissues Fibrin-targeting immunotherapy protects against neuroinflammation and neurodegeneration Colonic epithelial miR-31 associates with the development of Crohn’s phenotypes NR2F1 stratifies dormant disseminated tumor cells in breast cancer patients The lineage-defining transcription factors SOX2 and NKX2-1 determine lung cancer cell fate and shape the tumor immune microenvironment Reservoir computing with a single delay-coupled non-linear mechanical oscillator Small-molecule-based regulation of RNA-delivered circuits in mammalian cells Dynamic intercellular transport modulates the spatial patterning of differentiation during early neural commitment Mammographic breast density assessment using deep learning: clinical implementation ERBB2 signaling drives supporting cell proliferation in vitro and apparent supernumerary hair cell formation in vivo in the neonatal mouse cochlea Comparison of the performance of common measures of weight regain after bariatric surgery for association with clinical outcomes Engineered nanoparticles bind elapid snake venom toxins and inhibit venom-induced dermonecrosis Modeling and prediction of clinical symptom trajectories in Alzheimer’s disease using longitudinal data Reprogramming normal human epithelial tissues to a common, lethal neuroendocrine cancer lineage Complement component C3 is highly expressed in human pancreatic islets and prevents β cell death via ATG16L1 interaction and autophagy regulation Conformational dynamics of the ABC transporter McjD seen by single‐molecule FRET Genome-wide identification of structure-forming repeats as principal sites of fork collapse upon ATR inhibition Electric field–induced release and measurement liquid biopsy for noninvasive early lung cancer assessment ERβ-mediated induction of cystatins results in suppression of TGFβ signaling and inhibition of triple-negative breast cancer metastasis Nondestructive, base-resolution sequencing of 5-hydroxymethylcytosine using a DNA deaminase Multi-axial self-organization properties of mouse embryonic stem cells into gastruloids Incorporation of macrophages into engineered skeletal muscle enables enhanced muscle regeneration Genetics of blood lipids among ~300,000 multi-ethnic participants of the Million Veteran Program Lifetime risk of common neurological diseases in the elderly population The pleiotropic effects of TNFα in breast cancer subtypes is regulated by TNFAIP3/A20 Consumption of red and processed meat and breast cancer incidence: a systematic review and meta-analysis of prospective studies Restoration of vision after de novo genesis of rod photoreceptors in mammalian retinas Adult spinal motoneurons change their neurotransmitter phenotype to control locomotion NLRP1 restricts butyrate producing commensals to exacerbate inflammatory bowel disease Combination therapy with anti-HIV-1 antibodies maintains viral suppression Fisetin is a senotherapeutic that extends health and lifespan Biofabrication of autologous human hepatocytes for transplantation: how do we get there? Preclinical performance of a pediatric mechanical circulatory support device: The PediaFlow ventricular assist device Overexpression of the VRK1 kinase, which is associated with breast cancer, induces a mesenchymal to epithelial transition in mammary epithelial cells An inhibitor of GSK3B and HDACs kills pancreatic cancer cells and slows pancreatic tumor growth and metastasis in mice Brain endothelial erythrophagocytosis and hemoglobin transmigration across brain endothelium: implications for pathogenesis of cerebral microbleeds MAVS deficiency induces gut dysbiotic microbiota conferring a proallergic phenotype Small molecule inhibits α-synuclein aggregation, disrupts amyloid fibrils, and prevents degeneration of dopaminergic neurons Active wetting of epithelial tissues Aging suppresses skin-derived circulating SDF1 to promote full-thickness tissue regeneration Structure of the human epithelial sodium channel by cryo-electron microscopy Covalent inhibitors of EGFR family protein kinases induce degradation of human Tribbles 2 (TRIB2) pseudokinase in cancer cells Changing dynamics of the drug overdose epidemic in the United States from 1979 through 2016 Functional classification of long non-coding RNAs by k-mer content Serum biomarker signature-based liquid biopsy for diagnosis of early-stage pancreatic cancer Genome-edited skin epidermal stem cells protect mice from cocaine-seeking behaviour and cocaine overdose Membrane-induced hydroelastic migration of a particle surfing its own wave CNS lymphatic drainage and neuroinflammation are regulated by meningeal lymphatic vasculature MicroRNA-141-3p negatively modulates SDF-1 expression in age dependent pathophysiology of human and murine bone marrow stromal cells A high throughput screen for next-generation leads targeting malaria parasite transmission Treatment of human glioblastoma with a live attenuated Zika virus vaccine candidate Disease-associated short tandem repeats co-localize with chromatin domain boundaries Experimental evaluation of the importance of colonization history in early-life gut microbiota assembly Biodegradation of ECM hydrogel promotes endogenous brain tissue restoration in a rat model of stroke Tissue-adhesive wirelessly powered optoelectronic device for metronomic photodynamic cancer therapy Large-scale plasma lipidomic profiling identifies lipids that predict cardiovascular events in secondary prevention Staufen1 links RNA stress granules and autophagy in a model of neurodegeneration Susceptible period for cardiovascular complications in patients recovering from sepsis COMRADES determines in vivo RNA structures and interactions Hepatic Ago2-mediated RNA silencing controls energy metabolism linked to AMPK activation and obesity-associated pathophysiology Mood variations decoded from multi-site intracranial human brain activity A fluid-to-solid jamming transition underlies vertebrate body axis elongation In vivo reprogramming of wound-resident cells generates skin epithelial tissue Direct generation of human cortical organoids from primary cells Cancer mutations and targeted drugs can disrupt dynamic signal encoding by the Ras-Erk pathway RandomiSed clinical trial assessing Use of an anti-inflammatoRy aGent in attenUating peri-operatiVe inflAmmatioN in non-meTastatic colon cancer – the S.U.R.G.U.V.A.N.T. trial SIRT7 has a critical role in bone formation by regulating lysine acylation of SP7/Osterix Epistatic control of intrinsic resistance by virulence genes in Listeria Neutrophil membrane-coated nanoparticles inhibit synovial inflammation and alleviate joint damage in inflammatory arthritis Junction-based lamellipodia drive endothelial cell rearrangements in vivo via a VE-cadherin-F-actin based oscillatory cell-cell interaction Visual rehabilitation training alters attentional networks in hemianopia: An fMRI study Gene editing restores dystrophin expression in a canine model of Duchenne muscular dystrophy Time-restricted feeding prevents obesity and metabolic syndrome in mice lacking a circadian clock Minimizing context dependency of gene networks using artificial cells Discovery of novel cell surface markers for purification of embryonic dopamine progenitors for transplantation in Parkinson’s disease animal models Treatment with mRNA coding for the necroptosis mediator MLKL induces antitumor immunity directed against neo-epitopes SIRT6 haploinsufficiency induces BRAFV600E melanoma cell resistance to MAPK inhibitors via IGF signalling Small molecules co-targeting CKIα and the transcriptional kinases CDK7/9 control AML in preclinical models Digitally tunable microfluidic bioprinting of multilayered cannular tissues County-level air quality and the prevalence of diagnosed chronic kidney disease in the US Medicare population The DNA methylation landscape of glioblastoma disease progression shows extensive heterogeneity in time and space Multimorbidity and survival for patients with acute myocardial infarction in England and Wales: Latent class analysis of a nationwide population-based cohort Intestinal metabolism and bioaccumulation of sucralose in adipose tissue in the rat Telomere shortening is a hallmark of genetic cardiomyopathies Association of variants in BAG3 with cardiomyopathy outcomes in African American individuals Lack of Sprouty 1 and 2 enhances survival of effector CD8 T cells and yields more protective memory cells Circulating tumor DNA measurements as early outcome predictors in diffuse large B-cell lymphoma A framework to rank genomic alterations as targets for cancer precision medicine: the ESMO Scale for Clinical Actionability of molecular Targets (ESCAT) Correlation between polar surface area and bioferroelectricity in DNA and RNA nucleobases Electrostatic lock in the transport cycle of the multidrug resistance transporter EmrE Mutation-independent rhodopsin gene therapy by knockdown and replacement with a single AAV vector Progressive massive fibrosis resurgence identified in U.S. coal miners filing for black lung benefits, 1970–2016 Integrated phosphorescence-based photonic biosensor (iPOB) for monitoring oxygen levels in 3D cell culture systems Huntingtin aggregation impairs autophagy, leading to Argonaute-2 accumulation and global microRNA dysregulation A linked organ-on-chip model of the human neurovascular unit reveals the metabolic coupling of endothelial and neuronal cells KIM-1 as a blood-based marker for early detection of kidney cancer: a prospective nested case-control study Sequestration of T cells in bone marrow in the setting of glioblastoma and other intracranial tumors Dysregulation in actin cytoskeletal organization drives increased stiffness and migratory persistence in polyploidal giant cancer cells Intestinal P-glycoprotein exports endocannabinoids to prevent inflammation and maintain homeostasis Cortisol facilitates the immune escape of human acute myeloid leukemia cells by inducing latrophilin 1 expression Photochemical 'in-air' combinatorial discovery of antimicrobial copolymers Wireless control of cellular function by activation of a novel protein responsive to electromagnetic fields Dysregulation of neuronal iron homeostasis as an alternative unifying effect of mutations causing familial Alzheimer’s disease Multisensory bionic limb to achieve prosthesis embodiment and reduce distorted phantom limb perceptions The environmental sensor AHR protects from inflammatory damage by maintaining intestinal stem cell homeostasis and barrier integrity Differences in neural stem cell identity and differentiation capacity drive divergent regenerative outcomes in lizards and salamanders Effect of platelet-rich plasma on chondrogenic differentiation of adipose- and bone marrow-derived mesenchymal stem cells Stretchable, implantable, nanostructured flow-diverter system for quantification of intra-aneurysmal hemodynamics Impact of edible cricket consumption on gut microbiota in healthy adults, a double-blind, randomized crossover trial Suppression of m6A reader Ythdf2 promotes hematopoietic stem cell expansion Optical imaging of metabolic dynamics in animals Evaluation of a novel rule-out myocardial infarction protocol incorporating high-sensitivity troponin T in a US hospital Orthogonal self-assembly of an organoplatinum(II) metallacycle and cucurbit[8]uril that delivers curcumin to cancer cells 18F-fluoroestradiol tumor uptake is heterogeneous and influenced by site of metastasis in breast cancer patients Hematopoietic cell-derived RELMα regulates hookworm immunity through effects on macrophages Prioritizing the needs of children in a changing climate Kinetic basis for DNA target specificity of CRISPR-Cas12a Remission of human type 2 diabetes requires decrease in liver and pancreas fat content but is dependent upon capacity for β cell recovery Transcriptional synergy as an emergent property defining cell subpopulation identity enables population shift Combining H-FABP and GFAP increases the capacity to differentiate between CT-positive and CT-negative patients with mild traumatic brain injury Kidney-targeted inhibition of protein kinase C-α ameliorates nephrotoxic nephritis with restoration of mitochondrial dysfunction A reliable murine model of bone metastasis by injecting cancer cells through caudal arteries Diffusible, highly bioactive oligomers represent a critical minority of soluble Aβ in Alzheimer’s disease brain An in vitro paradigm to assess potential anti-Aβ antibodies for Alzheimer’s disease Magnetic drug targeting: a novel treatment for intramedullary spinal cord tumors Glial acetate metabolism is increased following a 72-h fast in metabolically healthy men and correlates with susceptibility to hypoglycemia Microfluidic chemotaxis platform for differentiating the roles of soluble and bound amyloid-β on microglial accumulation A three-dimensional human neural cell culture model of Alzheimer's disease A 3D human triculture system modeling neurodegeneration and neuroinflammation in Alzheimer’s disease Repeated exposure to heat stress induces mitochondrial adaptation in human skeletal muscle Wnt/PCP controls spreading of Wnt/β-catenin signals by cytonemes in vertebrates Self-assembly of embryonic and two extra-embryonic stem cell types into gastrulating embryo-like structures Gene exchange drives the ecological success of a multi-host bacterial pathogen Hippocampal projections to the anterior olfactory nucleus differentially convey spatiotemporal information during episodic odour memory Topical curcumin nanocarriers are neuroprotective in eye disease Visual impairment and progressive phthisis bulbi caused by recessive pathogenic variant in MARK3 Ex vivo biomechanical characterization of syringe-needle ejections for intracerebral cell delivery Compressed collagen enhances stem cell therapy for corneal scarring Human limbal biopsy-derived stromal stem cells prevent corneal scarring Concise review: stem cells in the corneal stroma Association between the New York sepsis care mandate and in-hospital mortality for pediatric sepsis Smart surgical catheter for c-reactive protein sensing based on an imperceptible organic transistor Human pluripotent reprogramming with CRISPR activators Smart bandage for monitoring and treatment of chronic wounds Fibronectin rescues estrogen receptor α from lysosomal degradation in breast cancer cells ETS transcription factors induce a unique UV damage signature that drives recurrent mutagenesis in melanoma Anti-tumour necrosis factor therapy for Dupuytren's disease: a randomised dose response proof of concept phase 2a clinical trial Thermal proteome profiling in bacteria: probing protein state in vivo Ras and rap signal bidirectional synaptic plasticity via distinct subcellular microdomains DNA-induced liquid phase condensation of cGAS activates innate immune signaling Unique Francisella phosphatidylethanolamine acts as a potent anti-inflammatory lipid Mechanism of 53BP1 activity regulation by RNA-binding TIRR and a designer protein Discovery of UDP-glycosyltransferases and BAHD-acyltransferases involved in the biosynthesis of the anti-diabetic plant metabolite montbretin Changes in pain intensity following discontinuation of long-term opioid therapy for chronic non-cancer pain Sampling molecular conformations and dynamics in a multiuser virtual reality framework Integrated time course omics analysis distinguishes immediate therapeutic response from acquired resistance Direct pericyte-to-neuron reprogramming via unfolding of a neural stem cell-like program Continuous biomarker monitoring by particle mobility sensing with single molecule resolution Control of spreading depression with electrical fields Human embryonic stem cell–derived cardiomyocytes restore function in infarcted hearts of non-human primates Costs and benefits of provocation in bacterial warfare Sympathetic neuronal activation triggers myeloid progenitor proliferation and differentiation A Ca2 -stimulated exosome release pathway in cancer cells is regulated by Munc13-4 Multiscale analysis of independent Alzheimer’s cohorts finds disruption of molecular, genetic, and clinical networks by human herpesvirus Locally coordinated synaptic plasticity of visual cortex neurons in vivo Resistance to enediyne antitumor antibiotics by sequestration Newfound effect of N -acetylaspartate in preventing and reversing aggregation of amyloid-beta in vitro How diverse retinal functions arise from feedback at the first visual synapse Precision therapeutic targeting of human cancer cell motility A naturally occurring antiviral ribonucleotide encoded by the human genome Multiple membrane extrusion sites drive megakaryocyte migration into bone marrow blood vessels The Drosophila immune deficiency pathway modulates enteroendocrine function and host metabolism Therapeutic luminal coating of the intestine Suppression of detyrosinated microtubules improves cardiomyocyte function in human heart failure Sustained release of targeted cardiac therapy with a replenishable implanted epicardial reservoir Potent laminin-inspired antioxidant regenerative dressing accelerates wound healing in diabetes BAFF neutralization aggravates atherosclerosis Caspase-1 inhibition prevents glial inflammasome activation and pyroptosis in models of multiple sclerosis Hippocampal calcifications: risk factors and association with cognitive function α-synuclein oligomers interact with ATP synthase and open the permeability transition pore in Parkinson’s disease Human plasma and serum extracellular small RNA reference profiles and their clinical utility Association between systolic blood pressure and dementia in the Whitehall II cohort study: role of age, duration, and threshold used to define hypertension Cost-effectiveness analysis of biopsy strategies for endometrial cancer diagnosis in women with postmenopausal bleeding: Pipelle sampling curette versus dilatation & curettage Gestational changes in buprenorphine exposure: a physiologically based pharmacokinetic analysis Low-dose NSAIDs reduce pain via macrophage targeted nanoemulsion delivery to neuroinflammation of the sciatic nerve in rat PAX3-FOXO1 transgenic zebrafish models identify HES3 as a mediator of rhabdomyosarcoma tumorigenesis Clinical trials in a dish: a perspective on the coming revolution in drug development Ultra-protective mechanical ventilation without extra-corporeal carbon dioxide removal for acute respiratory distress syndrome Testosterone is an endogenous regulator of BAFF and splenic B cell number Local immunomodulation with Fas ligand-engineered biomaterials achieves allogeneic islet graft acceptance TMS-induced neuronal plasticity enables targeted remodeling of visual cortical maps BigSCale: an analytical framework for big-scale single-cell data Computationally identified novel agonists for GPRC6A Epitope-based vaccine design yields fusion peptide-directed antibodies that neutralize diverse strains of HIV-1 Immune recognition of somatic mutations leading to complete durable regression in metastatic breast cancer Extracellular matrix-based materials for regenerative medicine Assessment of follow-up care after emergency department presentation for mild traumatic brain injury and concussion: results from the TRACK-TBI study A randomized trial of a family-support intervention in intensive care units Restoring vision Expanded autologous regulatory T-lymphocyte infusions in ALS A causal mechanism for childhood acute lymphoblastic leukaemia Stabilized single-injection inactivated polio vaccine elicits a strong neutralizing immune response Xenoprotein engineering via synthetic libraries Genomes of all known members of a Plasmodium subgenus reveal paths to virulent human malaria 3′ UTR shortening represses tumor-suppressor genes in trans by disrupting ceRNA crosstalk Analysis of red blood cell partitioning at bifurcations in simulated microvascular networks Associations of egg consumption with cardiovascular disease in a cohort study of 0.5 million Chinese adults Microfluidics-enabled multimaterial maskless stereolithographic bioprinting Dual-function injectable angiogenic biomaterial for the repair of brain tissue following stroke The RNA-binding protein Celf1 post-transcriptionally regulates p27Kip1 and Dnase2b to control fiber cell nuclear degradation in lens development Procalcitonin-guided use of antibiotics for lower respiratory tract infection Cross-specificity of protective human antibodies against Klebsiella pneumoniae LPS O-antigen S-nitrosylation of β-arrestins biases receptor signaling and confers ligand independence Spatial mutation patterns as markers of early colorectal tumor cell mobility Staphylococcus aureus utilizes host-derived lipoprotein particles as sources of fatty acids Sheathless inertial cell focusing and sorting with serial reverse wavy channel structures Benefits and safety of dietary protein for bone health—an expert consensus paper endorsed by the European Society for Clinical and Economical Aspects of Osteopororosis, Osteoarthritis, and Musculoskeletal Diseases and by the International Osteoporos Dual-wavelength 3D photoacoustic imaging of mammalian cells using a photoswitchable phytochrome reporter protein Platelets expressing IgG receptor FcγRIIA/CD32A determine the severity of experimental anaphylaxis Have we made progress with educational services for students with TBI NDF, a nucleosome destabilizing factor that facilitates transcription through nucleosomes Sharpening of hierarchical visual feature representations of blurred images Human gut microbiota predicts susceptibility to Vibrio cholera infection Negative feedback phosphorylation of Gγ subunit Ste18 and the Ste5 scaffold synergistically regulates MAPK activation in yeast Broadly neutralizing antibodies from human survivors target a conserved site in the Ebola virus glycoprotein HR2–MPER region Bone marrow is a major parasite reservoir in Plasmodium vivax infection Centrosome amplification arises before neoplasia and increases upon p53 loss in tumorigenesis TAR DNA-binding protein 43 and disrupted in schizophrenia 1 coaggregation disrupts dendritic local translation and mental function in frontotemporal lobar degeneration Coarse particulate matter (PM2.5–10) in Los Angeles Basin air induces expression of inflammation and cancer biomarkers in rat brains Nfat/calcineurin signaling promotes oligodendrocyte differentiation and myelination by transcription factor network tuning Validating the concept of mutational signatures with isogenic cell models Overexpression of Cx43 in cells of the myocardial scar: Correction of post-infarct arrhythmias through heterotypic cell-cell coupling Impact of healthy lifestyle factors on life expectancies in the US population Enzymatic or in vivo installation of propargyl groups in combination with click chemistry for the enrichment and detection of methyltransferase target sites in RNA Oral administration and detection of a near-infrared molecular imaging agent in an orthotopic mouse model for breast cancer screening Memory deficiency, cerebral amyloid angiopathy, and amyloid-β plaques in APP PS1 double transgenic rat model of Alzheimer’s disease DNA methylation and regulatory elements during chicken germline stem cell differentiation Spatial heterogeneity and evolutionary dynamics modulate time to recurrence in continuous and adaptive cancer therapies Multifunctional biophotonic nanostructures inspired by the longtail glasswing butterfly for medical devices Precise multimodal optical control of neural ensemble activity Shared strategies for β-lactam catabolism in the soil microbiome Radiomic features on MRI enable risk categorization of prostate cancer patients on active surveillance: preliminary findings Training a cell-level classifier for detecting basal-cell carcinoma by combining human visual attention maps with low-level handcrafted features A deep-learning classifier identifies patients with clinical heart failure using whole-slide images of H&E tissue Determinants of response and resistance to CD19 chimeric antigen receptor (CAR) T cell therapy of chronic lymphocytic leukemia γδ T cells producing interleukin-17A regulate adipose regulatory T cell homeostasis and thermogenesis Long ncRNA A-ROD activates its target gene DKK1 at its release from chromatin Proton-pump inhibitors and long-term risk of community-acquired pneumonia in older adults A new method for the high-precision assessment of tumor changes in response to treatment Cardiac mTORC1 dysregulation impacts stress adaptation and survival in Huntington's disease Drought-sensitivity of fine dust in the U.S. Southwest: Implications for air quality and public health under future climate change Detection of widespread horizontal pleiotropy in causal relationships inferred from Mendelian randomization between complex traits and diseases Neuropsychological predictors of long-term (10 years) mild cognitive impairment stability Age is relative—impact of donor age on induced pluripotent stem cell-derived cell functionality An exome-wide sequencing study of lipid response to high-fat meal and fenofibrate in Caucasians from the GOLDN cohort In silico optimization of a guava antimicrobial peptide enables combinatorial exploration for peptide design Neoadjuvant PD-1 blockade in resectable lung cancer High-speed live-cell interferometry: a new method for quantifying tumor drug resistance and heterogeneity The long non‐coding RNA Paupar promotes KAP1‐dependent chromatin changes and regulates olfactory bulb neurogenesis An in vivo model of functional and vascularized human brain organoids A single injection of crystallizable fragment domain–modified antibodies elicits durable protection from SHIV infection Potent antitumor efficacy of anti-GD2 CAR T cells in H3-K27M diffuse midline gliomas Risk and prognosis of cancer after lower limb arterial thrombosis The dynamics of concussion: mapping pathophysiology, persistence, and recovery with causal-loop diagramming Artificial intelligence estimation of carotid-femoral pulse wave velocity using carotid waveform Use of antiepileptic drugs and dementia risk-an analysis of Finnish health register and German health insurance data Highly scalable generation of DNA methylation profiles in singles cells Gain of toxic apolipoprotein E4 effects in human iPSC-derived neurons is ameliorated by a small-molecule structure corrector Hemodynamic forces tune the arrest, adhesion, and extravasation of circulating tumor cells Adipocyte p62/SQSTM1 suppresses tumorigenesis through opposite regulations of metabolism in adipose tissue and tumor Simultaneous lineage tracing and cell-type identification using CRISPR-Cas9-induced genetic scars Machine learning detects pan-cancer ras pathway activation in The Cancer Genome Atlas State estimation for a penicillin fed-batch process combining particle filtering methods with online and time delayed offline measurements Mitochondrial DNA and TLR9 drive muscle inflammation upon Opa1 deficiency Proprioceptive and cutaneous sensations in humans elicited by intracortical microstimulation Natural regulatory mutations elevate the fetal globin gene via disruption of BCL11A or ZBTB7A binding APC inhibits ligand-independent Wnt signaling by the clathrin endocytic pathway Evaluation of 1C-Me-NB1 as a potential PET radioligand for measuring GluN2B-containing NMDA receptors, drug occupancy, and receptor cross talk A global transcriptional network connecting noncoding mutations to changes in tumor gene expression Nanoengineered injectable hydrogels for wound healing application MicroRNA-17-92 is required for T-cell and B-cell pathogenicity in chronic graft-versus-host disease in mice Ablation of insulin receptor substrates 1 and 2 suppresses Kras-driven lung tumorigenesis Transcatheter laceration of aortic leaflets to prevent coronary obstruction during transcatheter aortic valve replacement Chronic nicotinamide riboside supplementation is well-tolerated and elevates NAD in healthy middle-aged and older adults Complete biosynthesis of noscapine and halogenated alkaloids in yeast Low-dose NSAIDs reduce pain via macrophage targeted nanoemulsion delivery to neuroinflammation of the sciatic nerve in rat Large volume syringe pump extruder for desktop 3D printers Referral regions for time-sensitive acute care conditions in the United States Genome-wide somatic variant calling using localized colored de Bruijn graphs Lymph node blood vessels provide exit routes for metastatic tumor cell dissemination in mice SpdC, a novel virulence factor, controls histidine kinase activity in Staphylococcus aureus Mutations in PMPCB encoding the catalytic subunit of the mitochondrial presequence protease cause neurodegeneration in early childhood Cancer-secreted hsa-miR-940 induces an osteoblastic phenotype in the bone metastatic microenvironment via targeting ARHGAP1 and FAM134A Design and syntheses of highly potent teixobactin analogues against Staphylococcus aureus, Methicillin-Resistant Staphylococcus aureus (MRSA), and Vancomycin-Resistant Enterococci (VRE) in vitro and in vivo Cell-free protein synthesis from genomically recoded bacteria enables multisite incorporation of noncanonical amino acids Suppression of diabetes by accumulation of non-islet-specific CD8 effector T cells in pancreatic islets Thyroid disrupting chemicals and brain development: an update Microglia remodel synapses by presynaptic trogocytosis and spine head filopodia induction Reconfigurable paramagnetic microswimmers: Brownian motion affects non-reciprocal actuation A bit-encoding based new data structure for time and memory efficient handling of spike times in an electrophysiological setup Dynamic protein assembly by programmable DNA strand displacement Phase 1 clinical study of an embryonic stem cell–derived retinal pigment epithelium patch in age-related macular degeneration Intracranial metastasis in fibrolamellar hepatocellular carcinoma Genetically encoded lipid–polypeptide hybrid biomaterials that exhibit temperature-triggered hierarchical self-assembly EFF-1 fusogen promotes phagosome sealing during cell process clearance in Caenorhabditis elegans Linear assembly of a human centromere on the Y chromosome Genome-wide analyses using UK Biobank data provide insights into the genetic architecture of osteoarthritis Apixaban in patients at risk of stroke undergoing atrial fibrillation ablation Capture Hi-C identifies putative target genes at 33 breast cancer risk loci Mid-infrared imaging in breast cancer tissue: an objective measure of grading breast cancer biopsies Antibiotic-induced population fluctuations and stochastic clearance of bacteria Nanofibrous peptide hydrogel elicits angiogenesis and neurogenesis without drugs, proteins, or cells A breathing atom-transfer radical polymerization: fully oxygen-tolerant polymerization inspired by aerobic respiration of cells Solid-phase synthesis of protein-polymers on reversible immobilization supports Learning by neural reassociation Balanced crystalloids versus saline in noncritically ill adults 4-1BB costimulation induces T cell mitochondrial function and biogenesis enabling cancer immunotherapeutic responses Skin electronics from scalable fabrication of an intrinsically stretchable transistor array C-terminal calcium binding of α-synuclein modulates synaptic vesicle interaction Terahertz microfluidic chips sensitivity-enhanced with a few arrays of meta-atoms Visualization of ligand-induced transmembrane signaling in the full-length human insulin receptor Sexual dimorphism in the behavioral responses and the immuno-endocrine status in D-galactose induced aging Cognitive functioning after hematopoietic cell transplantation for hematologic malignancy: results from a prospective longitudinal study Association of epidural stimulation with cardiovascular function in an individual with spinal cord injury RIPK1-mediated induction of mitophagy compromises the viability of extracellular-matrix-detached cells Very long-chain tear film lipids produced by fatty acid elongase ELOVL1 prevent dry eye disease in mice Differential roles of the Drosophila EMT-inducing transcription factors Snail and Serpent in driving primary tumor growth Rev-erbα dynamically modulates chromatin looping to control circadian gene transcription A vitamin B12 conjugate of Exendin-4 improves glucose tolerance without associated nausea or hypophagia in rodents Daple coordinates organ-wide and cell-intrinsic polarity to pattern inner-ear hair bundles The polyploid state plays a tumor-suppressive role in the liver Rehealable, fully recyclable, and malleable electronic skin enabled by dynamic covalent thermoset nanocomposite Intra-atrial dyssynchrony during sinus rhythm predicts recurrence after the first catheter ablation for atrial fibrillation Positively selected enhancer elements endow osteosarcoma cells with metastatic competence Small interfering RNAs based on huntingtin trinucleotide repeats are highly toxic to cancer cells Multiplex glycan bead array for high throughput and high content analyses of glycan binding proteins Programming of Schwann cells by Lats1/2-TAZ/YAP signaling drives malignant peripheral nerve sheath tumorigenesis Risk factors in Swedish young men for amyotrophic lateral sclerosis in adulthood Aggressive triple negative breast cancers have unique molecular signature on the basis of mitochondrial genetic and functional defects Ribosome incorporation into somatic cells promotes lineage transdifferentiation towards multipotency Ibrutinib inhibition of ERBB4 reduces cell growth in a WNT5A-dependent manner Cataract in patients with diabetes mellitus—incidence rates in the UK and risk factors Bioresorbable optical fiber Bragg gratings Secretion-mediated STAT3 activation promotes self-renewal of glioma stem-like cells during hypoxia Olig2 and Hes regulatory dynamics during motor neuron differentiation revealed by single cell transcriptomics Differential association of microvascular attributions with cardiovascular disease in patients with long duration of type 1 diabetes In vivo wireless photonic photodynamic therapy Relaxin reverses inflammatory and immune signals in aged hearts Mimicking embedded vasculature structure for 3D cancer on a chip approaches through micromilling De novoexpression of human polypeptideN-acetylgalactosaminyltransferase 6 (GalNAc-T6) in colon adenocarcinoma inhibits the differentiation of colonic epithelium Chromosomal instability during neurogenesis in Huntington's disease Distinct epigenetic programs regulate cardiac myocyte development and disease in the human heart in vivo Specific expression of PD-L1 in RELA-fusion supratentorial ependymoma: Implications for PD-1-targeted therapy Circadian rest-activity pattern changes in aging and preclinical Alzheimer disease Cryo-EM structures of PRC2 simultaneously engaged with two functionally distinct nucleosomes Structures of human PRC2 with its cofactors AEBP2 and JARID2 Male-specific IL-33 expression regulates sex-dimorphic EAE susceptibility Shared genetic effects on chromatin and gene expression indicate a role for enhancer priming in immune response Targeting flavin-containing enzymes eliminates cancer stem cells (CSCs), by inhibiting mitochondrial respiration: Vitamin B2 (Riboflavin) in cancer therapy Sensitization of hypoxic tumors to radiation therapy using ultrasound sensitive oxygen microbubbles Tumor-specific T-Cells engineered to overcome tumor immune evasion induce clinical responses in patients with relapsed Hodgkin lymphoma Safety and efficacy of immunotherapy with the recombinant B-cell epitope–based grass pollen vaccine BM32 Primary cilium-mediated retinal pigment epithelium maturation is disrupted in ciliopathy patient cells Removal of oral biofilm on an implant fixture by a cavitating jet Modeling the ACMG/AMP variant classification guidelines as a Bayesian classification framework Detection and localization of surgically resectable cancers with a multi-analyte blood test Evidence for convergent evolution of SINE-directed Staufen-mediated mRNA decay Loss of an androgen-inactivating and isoform-specific HSD17B4 splice form enables emergence of castration-resistant prostate cancer Co-activation of GR and PPARγ in murine skin prevents worsening of atopic march Structures of β-klotho reveal a ‘zip code’-like mechanism for endocrine FGF signalling Genomic and proteomic resolution of heterochromatin and its restriction of alternate fate genes Ablation of endothelial VEGFR1 improves metabolic dysfunction by inducing adipose tissue browning Polygenic contribution in individuals with early-onset coronary artery disease Multi-day rhythms modulate seizure risk in epilepsy Beta blocker use correlates with better overall survival in metastatic melanoma patients and improves the efficacy of immunotherapies in mice Reprogramming the activatable peptide display function of adeno-associated virus nanoparticles Hedgehog pathway drives fusion-negative rhabdomyosarcoma initiated from non-myogenic endothelial progenitors Whole blood stabilization for the microfluidic isolation and molecular characterization of circulating tumor cells TDP-43 pathology disrupts nuclear pore complexes and nucleocytoplasmic transport in ALS/FTD A TFIID-SAGA perturbation that targets MYB and suppresses acute myeloid leukemia Glial responses to implanted electrodes in the brain Enhancing recovery from sepsis, a review Endogenous reprogramming of alpha cells into beta cells, induced by viral gene therapy, reverses autoimmune diabetes Reversible retinal vessel closure from VEGF-induced leukocyte plugging A tunable microfluidic 3D stenosis model to study leukocyte-endothelial interactions in atherosclerosis Amphiphilic nanocarrier-induced modulation of PLK1 and miR-34a leads to improved therapeutic response in pancreatic cancer Programmed platelet derived growth factor‐bb and bone morphogenetic protein‐2 delivery from a hybrid calcium phosphate/alginate scaffold Modern therapeutic approaches for noninfectious ocular diseases involving inflammation TGF-β receptor I/II trafficking and signaling at primary cilia are inhibited by ceramide to attenuate cell migration and tumor metastasis Food-grade cationic antimicrobial ε-polylysine transiently alters the gut microbial community and predicted metagenome function in CD-1 mice Interferon-beta represses cancer stem cell properties in triple-negative breast cancer EGFR feedback-inhibition by Ran-binding protein 6 is disrupted in cancer Substrate-driven chemotactic assembly in an enzyme cascade The Std1 activator of the Snf1/AMPK kinase controls glucose response in yeast by a regulated protein aggregation Direct electrical stimulation of the amygdala enhances declarative memory in humans The oncolytic virus, MG1, targets and eliminates latently HIV-1-infected cells: implications for an HIV cure ERBB3 and NGFR mark a distinct skeletal muscle progenitor cell in human development and hPSCs Sphingosine and dihydrosphingosine as biomarkers for multiple sclerosis identified by metabolomic profiling using coupled UPLC-MS Lipid bodies containing oxidatively truncated lipids block antigen cross-presentation by dendritic cells in cancer Efficacy of educational video game versus traditional educational apps at improving physician decision making in trauma triage: randomized controlled trial Effect of high-intensity treadmill exercise on motor symptoms in patients with de novo Parkinson disease: a phase 2 randomized clinical trial Injecting instructions into premotor cortex Simple detection of telomere fusions in pancreatic cancer, intraductal papillary mucinous neoplasm, and pancreatic cyst fluid Immunoproteasome inhibition prevents chronic antibody-mediated allograft rejection in renal transplantation Pharmacological inhibition of REV-ERB stimulates differentiation, inhibits turnover and reduces fibrosis in dystrophic muscle Higher blood urea nitrogen is associated with increased risk of incident diabetes mellitus Efficient protein production by yeast requires global tuning of metabolism Clinical implications of Plasmodium resistance to atovaquone/proguanil: a systematic review and meta-analysis Runx3 programs CD8 T cell residency in non-lymphoid tissues and tumours mTORC2 promotes tumorigenesis via lipid synthesis Do viruses exchange genes across superkingdoms of life? Second-degree burns with six etiologies treated with autologous noncultured cell-spray grafting Nitro-oleic acid (NO2OA) release enhances regional angiogenesis in a rat abdominal wall defect model Heart valve scaffold fabrication: Bioinspired control of macro-scale morphology, mechanics and micro-structure A melanin-mediated cancer immunotherapy patch TDP-43 accelerates age-dependent degeneration of interneurons Hit-and-run epigenetic editing prevents senescence entry in primary breast cells from healthy donors Thermostable exoshells fold and stabilize recombinant proteins Nonimmune cells equipped with T-cell-receptorlike signaling for cancer cell ablation Inhibition of TRF1 telomere protein impairs tumor initiation and progression in glioblastoma mouse models and patient-derived xenografts ER-associated degradation regulates Alzheimer’s amyloid pathology and memory function by modulating γ-secretase activity A data-driven modeling approach to identify disease-specific multi-organ networks driving physiological dysregulation Small molecule promotes β-catenin citrullination and inhibits Wnt signaling in cancer Structure-guided chemical modification of guide RNA enables potent non-viral in vivo genome editing Inflammation-induced IgA cells dismantle anti-liver cancer immunity BCAT1 restricts αKG levels in AML stem cells leading to IDHmut-like DNA hypermethylation Identification of unique neoantigen qualities in long-term survivors of pancreatic cancer A neoantigen fitness model predicts tumour response to checkpoint blockade immunotherapy Single-cell virology: on-chip investigation of viral infection dynamics Near-infrared remotely triggered drug-release strategies for cancer treatment Regeneration of the entire human epidermis using transgenic stem cells Clinical decision support for in-hospital AKI Understanding tissue-specific gene regulation Fibroblast activation protein augments progression and metastasis of pancreatic ductal adenocarcinoma Common and cell-type specific responses to anti-cancer drugs revealed by high throughput transcript profiling Interleukin33 deficiency causes tau abnormality and neurodegeneration with Alzheimer-like symptoms in aged mice Isoform‐specific localization of DNMT3A regulates DNA methylation fidelity at bivalent CpG islands Virtual reality improves embodiment and neuropathic pain caused by spinal cord injury Long term effect of intensive lifestyle intervention on cerebral blood flow Modulation of inflammation in brain: a matter of fat Synthetic beta cells for fusion-mediated dynamic insulin secretion Safety and efficacy of focused ultrasound thalamotomy for patients with medication-refractory, tremor-dominant Parkinson Disease Aptamer-functionalized neural recording electrodes for the direct measurement of cocaine in vivo Transcription factor ISX mediates the cross talk between diet and immunity PKM2 methylation by CARM1 activates aerobic glycolysis to promote tumorigenesis Atopic asthmatic immune phenotypes associated with airway microbiota and airway obstruction Synergistic malaria vaccine combinations identified by systematic antigen screening Small GTPase ARF6 controls VEGFR2 trafficking and signaling in diabetic retinopathy Isolation of exosomes from whole blood by integrating acoustics and microfluidics Validation of a metastatic assay using biopsies to improve risk stratification in patients with prostate cancer treated with radical radiation therapy Mfsd2b is essential for the sphingosine-1-phosphate export in erythrocytes and platelets Synthetic hydrogels for human intestinal organoid generation and colonic wound repair Novel nanoparticles with Cr3 substituted ferrite for self-regulating temperature hyperthermia PEBP1 wardens ferroptosis by enabling lipoxygenase generation of lipid death signals Genetic effects on gene expression across human tissues Identification of 76 novel B1 metallo-β-lactamases through large-scale screening of genomic and metagenomic data Sensitivity to BUB1B inhibition defines an alternative classification of glioblastoma CCND2 overexpression enhances the regenerative potency of human induced pluripotent stem cell-derived cardiomyocytes: remuscularization of injured ventricle A novel Fer/FerT targeting compound selectively evokes metabolic stress and necrotic death in malignant cells Bioinspired flexible microfluidic shear force sensor skin Acute myeloid leukaemia disrupts endogenous myelo-erythropoiesis by compromising the adipocyte bone marrow niche Is abdominal hypopressive technique effective in the prevention and treatment of pelvic floor dysfunction? Marketing or evidence from high-quality clinical trials? Molecular analysis of high-grade serous ovarian carcinoma with and without associated serous tubal intra-epithelial carcinoma Determination of the impact of melanoma surgical timing on survival using the National Cancer Database Cbfβ governs osteoblast−adipocyte lineage commitment through enhancing β-catenin signaling and suppressing adipogenesis gene expression Angiopoietin-like 4 induces a β-catenin-mediated upregulation of ID3 in fibroblasts to reduce scar collagen expression A synthetic DNA-binding inhibitor of SOX2 guides human induced pluripotent stem cells to differentiate into mesoderm Induced pluripotent stem cell-derived neural stem cell therapy enhances recovery in an ischemic stroke pig model Tension creates an endoreplication wavefront that leads regeneration of epicardial tissue Effects of autogenous bone marrow aspirate concentrate on radiographic integration of femoral condylar osteochondral allografts Prevention of Alzheimer's Disease: lessons learned and applied Chemical modulation of in vivo macrophage function with subpopulation-specific fluorescent prodrug conjugates Prostaglandin E1 and its analog misoprostol inhibit human CML stem cell self-renewal via EP4 receptor activation and repression of AP-1 A novel neural prediction error found in anterior cingulate cortex ensembles O-Glycosylation modulates the stability of epidermal growth factor-like repeats and thereby regulates Notch trafficking Deletion of interleukin 1 receptor-associated kinase 1 (Irak1) improves glucose tolerance primarily by increasing insulin sensitivity in skeletal muscle Model-based design of RNA hybridization networks implemented in living cells Mechanistic investigation of the specific anticancer property of artemisinin and its combination with aminolevulinic acid for enhanced anticolorectal cancer activity A recombinant human ADAMTS-13: first-in-human study evaluating pharmacokinetics, safety and tolerability in cTTP patients A cargo-sorting DNA robot A predictive model for selective targeting of the Warburg Effect through GAPDH inhibition with a natural product Polymicrobial sepsis impairs bystander recruitment of effector cells to infected skin despite optimal sensing and alarming function of skin resident memory CD8 T cells Locally induced adipose tissue browning by microneedle patch for obesity treatment Neuronal inhibition of the autophagy nucleation complex extends life span in post-reproductive C. elegans Shape-specific nanoceria mitigate oxidative stress-induced calcification in primary human valvular interstitial cell culture In vivo induction of regulatory T cells promotes allergen tolerance and suppresses allergic contact dermatitis Tau exacerbates excitotoxic brain damage in an animal model of stroke Distinct mesenchymal lineages and niches promote epithelial self-renewal and myofibrogenesis in the lung Optical coherence tomography identifies outer retina thinning in frontotemporal degeneration A functional genomics predictive network model identifies regulators of inflammatory bowel disease High resolution 3-Dimensional imaging of the human cardiac conduction system from microanatomy to mathematical modeling The burden and etiology of diarrheal illness in developing countries Taxane-mediated radiosensitization derives from chromosomal missegregation on tripolar mitotic spindles orchestrated by AURKA and TPX2 Human plasma metabolomics study across all stages of age-related macular degeneration identifies potential lipid biomarkers Discovery of a proteolytic flagellin family in diverse bacterial phyla that assembles enzymatically active flagella Glia-specific enhancers and chromatin structure regulate NFIA expression and glioma tumorigenesis A fatal outbreak of ST11 carbapenem-resistant hypervirulent Klebsiella pneumoniae in a Chinese hospital: a molecular epidemiological study β2-Adrenoreceptor is a regulator of the α-synuclein gene driving risk of Parkinson’s disease LMO1 synergizes with MYCN to promote neuroblastoma initiation and metastasis Signals from the adipose microenvironment and the obesity–cancer link—a systematic review Pharmacological inhibition of the DNA damage checkpoint prevents radiation-induced oocyte death Identification of new susceptibility loci for type 2 diabetes and shared etiological pathways with coronary heart disease CNPY2 is a key initiator of the PERK–CHOP pathway of the unfolded protein response Inhibition of autophagy limits vertical transmission of Zika virus in pregnant mice Smac mimetics and oncolytic viruses synergize in driving anticancer T-cell responses through complementary mechanisms The deacetylase HDAC6 mediates endogenous neuritic tau pathology Synthetic quorum sensing in model microcapsule colonies Microbial regulation of microRNA expression in the amygdala and prefrontal cortex Peripherally derived FGF21 promotes remyelination in the central nervous system Interactions between fibroblastic reticular cells and B cells promote mesenteric lymph node lymphangiogenesis Feeding releases endogenous opioids in humans Anti-inflammatory therapy with canakinumab for atherosclerotic disease Stimulation of functional neuronal regeneration from Müller glia in adult mice Microglia turnover with aging and in an Alzheimer´s model via long-term in vivo single-cell imaging Prolonged human neural stem cell maturation supports recovery in injured rodent CNS Proteasome activity regulates CD8 T lymphocyte metabolism and fate specification Secreted protein Del-1 regulates myelopoiesis in the hematopoietic stem cell niche Neuroprotective effects of trigeminal nerve stimulation in severe traumatic brain injury Aurora-B kinase pathway controls the lateral to end-on conversion of kinetochore-microtubule attachments in human cells BACE inhibition-dependent repair of Alzheimer's pathophysiology Mesoscopic adaptive resolution scheme toward understanding of interactions between sickle cell fibers Transcriptomic biomarkers to discriminate bacterial from nonbacterial infection in adults hospitalized with respiratory illness Implications for breast cancer treatment from increased autotaxin production in adipose tissue after radiotherapy Cell segregation and border sharpening by Eph receptor–ephrin-mediated heterotypic repulsion Computational integration of nanoscale physical biomarkers and cognitive assessments for Alzheimer’s disease diagnosis and prognosis The role of retinal carotenoids and age on neuroelectric indices of attentional control among early to middle-aged adults Structural and functional substitution of deleted primary sensory neurons by new growth from intrinsic spinal cord nerve cells: an alternative concept in reconstruction of spinal cord circuits Necroptosis activation in Alzheimer's disease Functional annotation of chemical libraries across diverse biological processes Inverted battery design as ion generator for interfacing with biosystems Genome editing abrogates angiogenesis in vivo Wnt signaling controls pro-regenerative Collagen XII in functional spinal cord regeneration in zebrafish Triggerable tough hydrogels for gastric resident dosage forms Synthetic quorum sensing in model microcapsule colonies Rare coding variants in PLCG2, ABI3, and TREM2 implicate microglial-mediated innate immunity in Alzheimer's disease Comparison of algorithms for the detection of cancer drivers at subgene resolution Deformation correction for image-guided liver surgery: An intraoperative assessment of fidelity Dll4 and Notch signalling couples sprouting angiogenesis and artery formation Transancestral mapping and genetic load in systemic lupus erythematosus Prosthetic valve endocarditis after surgical aortic valve replacement Dynamic responses of the adrenal steroidogenic regulatory network Infant gut microbiome associated with cognitive development Halogenation of glycopeptide antibiotics occurs at the amino acid level during non-ribosomal peptide synthesis Nonnutritive sweeteners and cardiometabolic health: a systematic review and meta-analysis of randomized controlled trials and prospective cohort studies Acute hemodynamic effects of inhaled sodium nitrite in pulmonary hypertension associated with heart failure with preserved ejection fraction RNA stores tau reversibly in complex coacervates Comparison of the VA and NIDILRR TBI model system cohorts Succinate and its G-protein-coupled receptor stimulates osteoclastogenesis Pretreatment fasting plasma glucose and insulin modify dietary weight loss success: results from 3 randomized clinical trials Tumor-targeted and clearable human protein-based MRI nanoprobes Rv3723/LucA coordinates fatty acid and cholesterol uptake in Mycobacterium tuberculosis Recruitment of Epac2A to insulin granule docking sites regulates priming for exocytosis Surface chemistry for cytosolic gene delivery and photothermal transgene expression by gold nanorods Cellular prion protein (PrPC) in the development of Merlindeficient tumors High-speed and scalable whole-brain imaging in rodents and primates Nanonet force microscopy for measuring forces in single smooth muscle cells of the human aorta Comorbid conditions delay diagnosis of colorectal cancer: a cohort study using electronic primary care records Lutein exerts anti-inflammatory effects in patients with coronary artery disease Whole-body profiling of cancer metastasis with single-cell resolution Microglial inflammatory signaling orchestrates the hypothalamic immune response to dietary excess and mediates obesity susceptibility Inhibition of IKKɛ and TBK1 improves glucose control in a subset of patients with type 2 diabetes Spatiotemporal regulation of autophagy during Caenorhabditis elegans aging Cell-cycle dynamics of chromosomal organization at single-cell resolution Risk of hospitalization with neurodegenerative disease after moderate-to-severe traumatic brain injury in the working-age population: A retrospective cohort study using the Finnish national health registries An immunogenic personal neoantigen vaccine for patients with melanoma Direct imaging of protein stability and folding kinetics in hydrogels Recurrent mutation of IGF signalling genes and distinct patterns of genomic rearrangement in osteosarcoma Sculpting neurotransmission during synaptic development by 2D nanostructured interfaces A pan-cancer genome-wide analysis reveals tumour dependencies by induction of nonsense-mediated decay Selective optogenetic control of purkinje cells in monkey cerebellum Hydrocortisone, vitamin C, and thiamine for the treatment of severe sepsis and septic shock A calcium- and light-gated switch to induce gene expression in activated neurons Landscape of innovation for cardiovascular pharmaceuticals: from basic science to new molecular entities Adaptive capacity: an evolutionary neuroscience model linking exercise, cognition, and brain health Rat intersubjective decisions are encoded by frequency-specific oscillatory contexts Zolpidem for the treatment of neurologic disorders: a systematic review Donor SIRPα polymorphism modulates the innate immune response to allogeneic grafts Multiscale model predicts increasing focal adhesion size with decreasing stiffness in fibrous matrices Left ventricular dysfunction switches mesenchymal stromal cells toward an inflammatory phenotype and impairs their reparative properties via toll-like receptor-4 clinical perspective Ratchet-like polypeptide translocation mechanism of the AAA disaggregase Hsp104 Microbial genetic composition tunes host longevity Antibacterial nucleoside-analog inhibitor of bacterial RNA polymerase A novel genetic technique in Plasmodium berghei allows liver stage analysis of genes required for mosquito stage development and demonstrates that de novo heme synthesis is essential for liver stage development in the malaria parasite Three mutations switch H7N9 influenza to human-type receptor specificity Hypothalamic regulation of distinct adult neural stem cells and neurogenesis Tropism, intracerebral distribution, and transduction efficiency of HIV- and SIV-based lentiviral vectors after injection into the mouse brain: a qualitative and quantitative in vivo study Sequential self-assembly of DNA functionalized droplets Atopic dermatitis and risk of hypertension, type-2 diabetes, myocardial infarction and stroke in a cross-sectional analysis from the Canadian Partnership for Tomorrow Project Pulsed cavitational ultrasound softening Potent inhibitor of drug-resistant HIV-1 strains identified from the medicinal plant Justicia gendarussa A genetic polymorphism repurposes the G-protein coupled and membrane-associated estrogen receptor GPER to a transcription factor-like molecule promoting paracrine signaling between stroma and breast carcinoma cells In situ bone tissue engineering via ultrasound-mediated gene delivery to endogenous progenitor cells in mini-pigs Drag reducing polymers decrease hepatic injury and metastases after liver ischemia-reperfusion Split-BioID a conditional proteomics approach to monitor the composition of spatiotemporally defined protein complexes HDAC1,2 inhibition and doxorubicin impair Mre11-dependent DNA repair and DISC to override BCR-ABL1-driven DSB repair in Philadelphia chromosome-positive B-cell precursor acute lymphoblastic leukemia A novel strategy to engineer pre-vascularized full-length dental pulp-like tissue constructs Polarity of varicosity initiation in central neuron mechanosensation Significant locus and metabolic genetic correlations revealed in genome-wide association study of anorexia nervosa Pyrimethamine significantly lowers cerebrospinal fluid Cu/Zn superoxide dismutase in amyotrophic lateral sclerosis patients with SOD1 mutations Association of amine biomarkers with incident dementia and Alzheimer's disease in the Framingham Study A scalable platform to identify fungal secondary metabolites and their gene clusters Dynamic subunit turnover in ESCRT-III assemblies is regulated by Vps4 to mediate membrane remodelling during cytokinesis ACK1/TNK2 regulates histone H4 Tyr88-phosphorylation and AR gene expression in castration-resistant prostate cancer A systems biology approach identifies FUT8 as a driver of melanoma metastasis Impact of vitamin A and carotenoids on the risk of tuberculosis progression Obesity accelerates Alzheimer-related pathology in APOE4 but not APOE3 mice Tactile defensiveness and impaired adaptation of neuronal activity in the Fmr1 knockout mouse model of autism Vitamin C and Doxycycline: A synthetic lethal combination therapy targeting metabolic flexibility in cancer stem cells (CSCs) Use of prescribed opioids before and after bariatric surgery: prospective evidence from a U.S. multicenter cohort study Adult murine cardiomyocytes exhibit regenerative activity with cell cycle reentry through STAT3 in the healing process of myocarditis Perirhinal firing patterns are sustained across large spatial segments of the task environment Engineered bacteria can function in the mammalian gut long-term as live diagnostics of inflammation JunB is essential for IL-23-dependent pathogenicity of Th17 cells Childhood predictors of cardiovascular disease in adulthood. A systematic review and meta-analysis Aberrant activation of the GIMAP enhancer by oncogenic transcription factors in T-cell acute lymphoblastic leukemia Protein-free formation of bone-like apatite: New insights into the key role of carbonation GLUT 1 receptor expression and circulating levels of fasting glucose in high grade serous ovarian cancer Specification and diversification of pericytes and smooth muscle cells from mesenchymoangioblasts Contralesional brain–computer interface control of a powered exoskeleton for motor recovery in chronic stroke survivors Use of a pedicled omental flap to reduce inflammation and vascularize an abdominal wall patch Endothelial TLR4 and the microbiome drive cerebral cavernous malformations Mutant KRAS promotes malignant pleural effusion formation Light-inducible antimiR-92a as a therapeutic strategy to promote skin repair in healing-impaired diabetic mice SGPL1 (sphingosine phosphate lyase 1) modulates neuronal autophagy via phosphatidylethanolamine production Dynamically and epigenetically coordinated GATA/ETS/SOX transcription factor expression is indispensable for endothelial cell differentiation TIAM1 variants improve clinical outcome in neuroblastoma Quantitative erythrocyte omega-3 EPA plus DHA levels are related to higher regional cerebral blood flow on brain SPECT Targeting latency-associated peptide promotes antitumor immunity Neonatal expression of RNA-binding protein IGF2BP3 regulates the human fetal-adult megakaryocyte transition Maintenance of persistent activity in a frontal thalamocortical loop The complex genetics of hypoplastic left heart syndrome Compositional changes in the gut mucus microbiota precede the onset of colitis-induced inflammation The host ubiquitin-dependent segregase VCP/p97 is required for the onset of human cytomegalovirus replication Outcomes of patients with double-hit lymphoma who achieve first complete remission A novel ALS-associated variant in UBQLN4 regulates motor axon morphogenesis Evaluating the safety of β-interferons in MS Humoral immune reconstitution kinetics following allogeneic hematopoietic stem cell transplantation in children: a maturation block of IgM memory B cells may lead to impaired antibody immune reconstitution Gut microbiome function predicts response to anti-integrin biologic therapy in inflammatory bowel diseases Topical delivery of anti-VEGF drugs to the ocular posterior segment using cell-penetrating peptides The single-parameter, structure-based IsoPSA assay demonstrates improved diagnostic accuracy for detection of any prostate cancer and high-grade prostate cancer compared to a concentration-based assay of total prostate-specific antigen Photosensitization priming of tumor microenvironments improves delivery of nanotherapeutics via neutrophil infiltration Identification of targetable ALK rearrangements in pancreatic ductal adenocarcinoma Impact of genomic profiling on the treatment and outcomes of patients with advanced gastrointestinal malignancies Platelets subvert T cell immunity against cancer via GARP-TGFβ axis Meeting report for NIH 2016 progenitor cell biology consortium cardiovascular tissue engineering 2016 Signalome-wide assessment of host cell response to hepatitis C virus Role of Akt-independent mTORC1 and GSK3β signaling in sublethal NMDA-induced injury and the recovery of neuronal electrophysiology and survival High-throughput, low-loss, low-cost, and label-free cell separation using electrophysiology-activated cell enrichment Identification of cardiac hemo-vascular precursors and their requirement of sphingosine-1-phosphate receptor 1 for heart development County-level cumulative environmental quality associated with cancer incidence CHD4 has oncogenic functions in initiating and maintaining epigenetic suppression of multiple tumor suppressor genes Red blood cells for glucose-responsive insulin delivery Cell-specific pallidal intervention induces long-lasting motor recovery in dopamine-depleted mice Population-based stroke and dementia incidence trends: age and sex variations Interaction of 12/15 lipoxygenase with fatty acids alters the leukocyte kinetics leading to improved post-myocardial infarction healing Birinapant sensitizes platinum-resistant carcinomas with high levels of cIAP to carboplatin therapy Brd4 modulates the innate immune response through Mnk2–eIF4E pathway-dependent translational control of IκBα The future of asthma research and development: a roadmap from the European Asthma Research and Innovation Partnership (EARIP) Decreased microRNA levels lead to deleterious increases in neuronal M2 muscarinic receptors in Spinal Muscular Atrophy models MicroRNA-210 enhances fibrous cap stability in advanced atherosclerotic lesions novelty and significance Evidence of strain structure in Plasmodium falciparum var gene repertoires in children from Gabon, West Africa Bicaudal C mutation causes myc and TOR pathway up-regulation and polycystic kidney disease-like phenotypes in Drosophila Trial of transplantation of HCV-infected kidneys into uninfected recipients MAN2A1–FER fusion gene is expressed by human liver and other tumor types and has oncogenic activity in mice Targeting genomic rearrangements in tumor cells through Cas9-mediated insertion of a suicide gene Data-driven modeling for precision medicine in pediatric acute liver failure Gene and mutation independent therapy via CRISPR-Cas9 mediated cellular reprogramming in rod photoreceptors The transcription factor MAFK induces EMT and malignant progression of triple-negative breast cancer cells through its target GPNMB Phylogenetic analysis of metastatic progression in breast cancer using somatic mutations and copy number aberrations Lyme disease ecology in a changing world: consensus, uncertainty and critical gaps for improving control Differentiation of V2a interneurons from human pluripotent stem cells Biopolymers codelivering engineered T cells and STING agonists can eliminate heterogeneous tumors Raft-based sphingomyelin interactions revealed by new fluorescent sphingomyelin analogs Tet2 loss leads to hypermutagenicity in haematopoietic stem/progenitor cells iPSC-derived human microglia-like cells to study neurological diseases Ultrafast laser-probing spectroscopy for studying molecular structure of protein aggregates Tumor-penetrating peptide enhances transcytosis of silicasome-based chemotherapy for pancreatic cancer Access granted: iRGD helps silicasome-encased drugs breach the tumor barrier PD-L1 interacts with CD80 to regulate graft-versus-leukemia activity of donor CD8 T cells Detection of interferon alpha protein reveals differential levels and cellular sources in disease IL-36γ signaling controls the induced regulatory T cell–Th9 cell balance via NFκB activation and STAT transcription factors mTORC1 controls the adaptive transition of quiescent stem cells from G0 to G(Alert) HGFA is an injury-regulated systemic factor that induces the transition of stem cells into GAlert Dynamic range adaptation in primary motor cortical populations In vivo evasion of MxA by avian influenza viruses requires human signature in the viral nucleoprotein Pdgf signalling guides neural crest contribution to the haematopoietic stem cell specification niche Structure of the mycobacterial ESX-5 type VII secretion system membrane complex by single-particle analysis Dectin 1 activation on macrophages by galectin 9 promotes pancreatic carcinoma and peritumoral immune tolerance Biophysical and functional characterization of hippocalcin mutants responsible for human dystonia Report on the National Eye Institute audacious goals initiative: replacement of retinal ganglion cells from endogenous cell sources Increasing efficiency of preclinical research by group sequential designs Technology versus biology: the limits of pre‐implantation genetic screening Early-life antibiotic treatment enhances the pathogenicity of CD4 T cells during intestinal inflammation Melanoma cells undergo aggressive coalescence in a 3D Matrigel model that is repressed by anti-CD44 Mutual regulation of tumour vessel normalization and immunostimulatory reprogramming Flexible and stretchable nanowire-coated fibers for optoelectronic probing of spinal cord circuits The burden of neurological disease in the United States: a summary report and call to action ANGPTL3 deficiency and protection against coronary artery disease CRISPR–Cas9 epigenome editing enables high-throughput screening for functional regulatory elements in the human genome Nanomolar concentration of blood-soluble drag-reducing polymer inhibits experimental metastasis of human breast cancer cells In vitro and in vivo evaluation of a novel integrated wearable artificial lung Reducing expression of synapse-restricting protein Ephexin5 ameliorates Alzheimer’s-like impairment in mice Confined space facilitates G-quadruplex formation Myosin-1E interacts with FAK proline-rich region 1 to induce fibronectin-type matrix Reduced DNA methylation and psychopathology following endogenous hypercortisolism – a genome-wide study Hybrid inorganic-organic capsules for efficient intracellular delivery of novel siRNAs against influenza A (H1N1) virus infection Rehabilitation for people living with dementia: A practical framework of positive support Microscopic characterization of the Brazilian giant samba virus Deficiency of the hepatokine selenoprotein P increases responsiveness to exercise in mice through upregulation of reactive oxygen species and AMP-activated protein kinase in muscle Therapy of primary and metastatic liver cancer by human iPS cell-derived myeloid cells producing interferon-β Proteogenomic integration reveals therapeutic targets in breast cancer xenografts Inflammation boosts bacteriophage transfer between Salmonella spp. Classification and adaptive behavior prediction of children with autism spectrum disorder based upon multivariate data analysis of markers of oxidative stress and DNA methylation Long noncoding RNAs and sulforaphane: a target for chemoprevention and suppression of prostate cancer Germline mutations in the Kallikrein 6 region and predisposition for aggressive prostate cancer Randomized trial of a hypofractionated radiation regimen for the treatment of localized prostate cancer Stable and potent selenomab-drug conjugates Electroacupuncture promotes CNS-dependent release of mesenchymal stem cells Vitamin D treatment during pregnancy prevents autism-related phenotypes in a mouse model of maternal immune activation An adipo-biliary-uridine axis that regulates energy homeostasis Structure of the active form of human origin recognition complex and its ATPase motor module Reduced regional grey matter volumes in pediatric obstructive sleep apnea Eosinophils are key regulators of perivascular adipose tissue and vascular functionality Phase separation of C9orf72 dipeptide repeats perturbs stress granule dynamics Inclisiran in patients at high cardiovascular risk with elevated LDL cholesterol Safety observations with three years of denosumab exposure: comparison between subjects who received denosumab during the randomized FREEDOM trial and subjects who crossed over to denosumab during the FREEDOM extension Targeting glutamate signalling in depression: progress and prospects A Drosophila model system to assess the function of human monogenic podocyte mutations that cause nephrotic syndrome Transfer of dysbiotic gut microbiota has beneficial effects on host liver metabolism Piloting a remission strategy in type 2 diabetes: results of a randomized controlled trial Vision loss after intravitreal injection of autologous “stem cells” for AMD Structural basis of substrate recognition by the multidrug resistance protein MRP1 Systematic mapping of RNA-chromatin interactions in vivo Tracking the fate and origin of clinically relevant adoptively transferred CD8 T cells in vivo The cumulative effects of intravenous antibiotic treatments on hearing in patients with cystic fibrosis Dietary prebiotics and bioactive milk fractions improve NREM sleep, enhance REM sleep rebound and attenuate the stress-induced decrease in diurnal temperature and gut microbial alpha diversity Enhanced dynamics of hydrated tRNA on nanodiamond surfaces: a combined neutron scattering and MD simulation study Analysis of the T cell response to Zika virus and identification of a novel CD8 T cell epitope in immunocompetent mice Therapeutic targeting of polycomb and BET bromodomain proteins in diffuse intrinsic pontine gliomas Abnormal capillary vasodynamics contribute to ictal neurodegeneration in epilepsy Host genotype and gut microbiome modulate insulin secretion and diet-induced metabolic phenotypes Low serum vitamin D during remission increases risk of clinical relapse in patients with ulcerative colitis Transient auditory nerve demyelination as a new mechanism for hidden hearing loss Correlation of long-term results of imatinib in advanced gastrointestinal stromal tumors with next-generation sequencing results A macrophage relay for long-distance signaling during postembryonic tissue remodeling Vitamin B 3 modulates mitochondrial vulnerability and prevents glaucoma in aged mice PAK4 interacts with p85 alpha: implications for pancreatic cancer cell migration RUNX1 cooperates with FLT3-ITD to induce leukemia Mining the human gut microbiota for immunomodulatory organisms Titanium dioxide nanoparticle ingestion alters nutrient absorption in an in vitro model of the small intestine Harnessing catalytic pumps for directional delivery of microparticles in microchambers Macromolecularly “caged” carbon nanoparticles for intracellular trafficking via switchable photoluminescence A prominent glycyl radical enzyme in human gut microbiomes metabolizes trans-4-hydroxy-l-proline Neuronal activity in ontogeny and oncology The nuclear transport receptor Importin-11 is a tumor suppressor that maintains PTEN protein Perturbations of the anti-ageing hormone Klotho in patients with type 1 diabetes and microalbuminuria Perinatal nicotine exposure impairs the maturation of glutamatergic inputs in the auditory brainstem Granulocyte colony-stimulating factor (G-CSF) promotes spermatogenic regeneration from surviving spermatogonia after high-dose alkylating chemotherapy Stepwise reprogramming of liver cells to a pancreas progenitor state by the transcriptional regulator Tgif2 Synchrotron x-ray fluorescence nanoprobe reveals target sites for organo-osmium complex in human ovarian cancer cells Abnormal degradation of the neuronal stress-protective transcription factor HSF1 in Huntington’s disease Arsenic promotes NF-Κb-mediated fibroblast dysfunction and matrix remodeling to impair muscle stem cell function A rapid screening method to evaluate the impact of nanoparticles on macrophages Structure and function of the mycobacterial transcription initiation complex with the essential regulator RbpA Blockade to pathological remodeling of infarcted heart tissue using a porcupine antagonist IL-27 limits type 2 immunopathology following parainfluenza virus infection MCT8 deficiency in Purkinje cells disrupts embryonic chicken cerebellar development Anti-SIRPα antibodies as a potential new tool for cancer immunotherapy Chemopreventive potential of in vitro fermented nuts in LT97 colon adenoma and primary epithelial colon cells Comparative effectiveness of vancomycin and metronidazole for the prevention of recurrence and death in patients with Clostridium difficile infection Alterations in the gut microbiota can elicit hypertension in rats Gene therapy restores auditory and vestibular function in a mouse model of Usher syndrome type 1c External size but not aBMD predicts structural and mass changes for women transitioning through menopause Experimental measurement of binding energy, selectivity, and allostery using fluctuation theorems Bone marrow-derived mesenchymal stem cells-derived exosomes promote survival of retinal ganglion cells through miRNA-dependent mechanisms A non-canonical mismatch repair pathway in prokaryotes Discovering novel phenotypes with automatically inferred dynamic models: a partial melanocyte conversion in Xenopus Plasma kallikrein mediates brain hemorrhage and edema caused by tissue plasminogen activator therapy in mice after stroke Feasibility study on cardiac arrhythmia ablation using high-energy heavy ion beams Wall teichoic acids mediate increased virulence in Staphylococcus aureus Targeting LOXL2 for cardiac interstitial fibrosis and heart failure treatment MicroRNA-194 promotes prostate cancer metastasis by inhibiting SOCS2 Data-driven modeling for precision medicine in pediatric acute liver failure Noninvasive targeted transcranial neuromodulation via focused ultrasound gated drug release from nanoemulsions Hysterectomy-corrected cervical cancer mortality rates reveal a larger racial disparity in the United States Nutritional considerations for healthy aging and reduction in age-related chronic disease Cryoelectron microscopy maps of human papillomavirus 16 reveal l2 densities and heparin binding site Pediatric non–Down syndrome acute megakaryoblastic leukemia is characterized by distinct genomic subsets with varying outcomes An extended fatty liver index to predict non-alcoholic fatty liver disease Micromotors spontaneously neutralize gastric acid for pH-responsive payload release Zika virus disrupts molecular fingerprinting of human neurospheres 3D bioprinting of functional human skin: production and in vivo analysis Post-Ebola reforms: ample analysis, inadequate action Hyperspectral phasor analysis enables multiplexed 5D in vivo imaging IL-6 controls resistance to radiation by suppressing oxidative stress via the Nrf2-antioxidant pathway in oral squamous cell carcinoma The descending diencephalic dopamine system is tuned to sensory stimuli Sleepiness and sleep-related breathing disorders in myotonic dystrophy and responses to treatment: a prospective cohort study Health-care-associated infections in neonates, children, and adolescents: an analysis of paediatric data from the European Centre for Disease Prevention and Control point-prevalence survey Deficiency of microRNA miR-34a expands cell fate potential in pluripotent stem cells Prevention of dietary-fat-fueled ketogenesis attenuates BRAF V600E tumor growth The ubiquitin ligase Smurf1 functions in selective autophagy of mycobacterium tuberculosis and anti-tuberculous host defense Flavivirus infection uncouples translation suppression from cellular stress responses A comparison of surrogate endpoints for all cause mortality in men with localized unfavorable-risk prostate cancer Therapeutic targeting of MLL degradation pathways in MLL-rearranged leukemia Evidence for opposing roles of Celsr3 and Vangl2 in glutamatergic synapse formation Insights into the mechanistic basis of plasmid-mediated colistin resistance from crystal structures of the catalytic domain of MCR-1 Biomarker signatures of aging Modular immune organoids with integrin ligand specificity differentially regulate ex vivo B cell activation MMTV-cre;Ccn6 knockout mice develop tumors recapitulating human metaplastic breast carcinomas Bortezomib for treatment of therapy-refractory anti-NMDA receptor encephalitis APE2 Zf-GRF facilitates 3′-5′ resection of DNA damage following oxidative stress Detection of viral RNA in tissues following plasma clearance from an Ebola virus infected patient Acute plasma tau relates to prolonged return to play after concussion GelMA encapsulated hDPSCs and HUVECs for dental pulp regeneration Whole genome relationships among Francisella bacteria of diverse origin define new species and provide specific regions for detection Nonsteroidal anti-inflammatory drugs and endometrial carcinoma mortality and recurrence Vav proteins are key regulators of Card9 signaling for innate antifungal immunity Cancer cell hyperactivity and membrane dipolarity monitoring via raman mapping of interfaced graphene: toward non-invasive cancer diagnostics Electrically oscillating plasmonic nanoparticles for enhanced DNA vaccination against hepatitis C virus Mechanisms of bacterial persistence during stress and antibiotic exposure Genome-wide association study of primary sclerosing cholangitis identifies new risk loci and quantifies the genetic relationship with inflammatory bowel disease Inhibitors of Mycobacterium tuberculosis DosRST signaling and persistence Protective immunity elicited by oral immunization of mice with salmonella enterica Serovar Typhimurium Braun Lipoprotein (Lpp) and Acetyltransferase (MsbB) mutants Influence of donor age on induced pluripotent stem cells Free serum hemoglobin is associated with brain atrophy in secondary progressive multiple sclerosis Clonal variation in drug and radiation response among glioma-initiating cells is linked to proneural-mesenchymal transition A conserved bacterial protein induces pancreatic beta cell expansion during zebrafish development ARID1A loss impairs enhancer-mediated gene regulation and drives colon cancer in mice Sex and race differences in the association between statin use and the incidence of Alzheimer disease NLRC3 is an inhibitory sensor of PI3K–mTOR pathways in cancer Sentinel lymph node biopsy for patients with early-stage breast cancer: American Society of Clinical Oncology clinical practice guideline update 2016 Deficiency in prohormone convertase PC1 impairs prohormone processing in Prader-Willi syndrome Respiratory syncytial virus infection enhances Pseudomonas aeruginosa biofilm growth through dysregulation of nutritional immunity Intrinsic subtype switching and acquired ERBB2/HER2 amplifications and mutations in breast cancer brain metastases Redefining the invertebrate RNA virosphere 5-Hydroxymethylcytosine localizes to enhancer elements and is associated with survival in glioblastoma patients G-CSF-induced sympathetic tone provokes fever and primes anti-mobilizing functions of neutrophils via PGE2 Reparative effects of interleukin-1 receptor antagonist in young and aged/co-morbid rodents after cerebral ischemia Epithelial-to-mesenchymal transition drives a pro-metastatic Golgi compaction process through scaffolding protein PAQR11 eEF2K/eEF2 pathway controls the excitation/inhibition balance and susceptibility to epileptic seizures Obesity: fermentable carbohydrates increase satiety signals 3D-CLEM reveals that a major portion of mitotic chromosomes is not chromatin Chronology of onset of mental disorders and physical diseases in mental-physical comorbidity - a national representative survey of adolescents Structure of a human astrovirus capsid - antibody complex and mechanistic insights into virus neutralization Synthetic recording and in situ readout of lineage information in single cells Molecular analysis of circulating tumor cells identifies distinct copy-number profiles in patients with chemosensitive and chemorefractory small-cell lung cancer Fear reduction without fear through reinforcement of neural activity that bypasses conscious exposure A single heterochronic blood exchange reveals rapid inhibition of multiple tissues by old blood Association of 3 different antihypertensive medications with hip and pelvic fracture risk in older adults: secondary analysis of a randomized clinical trial Relationship of lutein and zeaxanthin levels to neurocognitive functioning: an fMRI study of older adults p15 expression differentiates nevus from melanoma Randomized trial of calcipotriol combined with 5-fluorouracil for skin cancer precursor immunotherapy ChromoplecticTPM3–ALK rearrangement in a patient with inflammatory myofibroblastic tumor who responded to ceritinib after progression on crizotinib Lactobacillus plantarum attenuates anxiety-related behavior and protects against stress-induced dysbiosis in adult zebrafish Decellularized zebrafish cardiac extracellular matrix induces mammalian heart regeneration ACSL4 dictates ferroptosis sensitivity by shaping cellular lipid composition Oxidized arachidonic and adrenic PEs navigate cells to ferroptosis Proteomic profiling reveals a specific role for translesion DNA polymerase η in the alternative lengthening of telomeres Structural analysis of X-Linked Retinoschisis mutations reveals distinct classes which differentially effect retinoschisin function Functional and genomic architecture of Borrelia burgdorferi-induced cytokine responses in humans Systemic therapy for previously untreated advanced BRAF-mutated melanoma Neuroplasticity following anterior cruciate ligament injury: a framework for visual-motor training approaches in rehabilitation Basal forebrain degeneration precedes and predicts the cortical spread of Alzheimer’s pathology Genome dynamics and molecular infection epidemiology of multi-drug resistant Helicobacter pullorum isolates obtained from broiler and country chickens in India Next-generation sequencing diagnostics of bacteremia in septic patients Weight loss following diet-induced obesity does not alter colon tumorigenesis in the AOM mouse model Kidney function after the first kidney stone event Oxidative guanine base damage regulates human telomerase activity The spatial structure of correlated neuronal variability A topical mitochondria-targeted redox cycling nitroxide mitigates oxidative stress induced skin damage Sensory dynamics of visual hallucinations in the normal population Shifts in macrophage phenotype at the biomaterial interface via IL-4 eluting coatings are associated with improved implant integration Statements of agreement from the targeted evaluation and active management (TEAM) approaches to treating concussion meeting held in Pittsburgh, October 15-16, 2015 Inflammation following traumatic brain injury in humans: insights from data-driven and mechanistic models into survival and death Characterisation of a flavonoid ligand of the fungal protein Alt a 1 NAD replenishment improves lifespan and healthspan in ataxia telangiectasia models via mitophagy and DNA repair Prospective longitudinal analysis of 2-hydroxyglutarate magnetic resonance spectroscopy identifies broad clinical utility for the management of patients with IDH-mutant glioma Pharmacologic activation of estrogen receptor increases mitochondrial function, energy expenditure, and brown adipose tissue Protective effects of mitochondria-targeted antioxidants and statins on cholesterol-induced osteoarthritis Association between androgen deprivation therapy and risk of dementia Molecular classification of Crohn's disease reveals two clinically relevant subtypes Evolution of protein phosphorylation across 18 fungal species Sustained virologic control in SIV macaques following short term ART and 47-mAb treatment Is a normal TSH synonymous with “euthyroidism” in levothyroxine monotherapy? Microenvironment-dependent growth of preneoplastic and malignant plasma cells in humanized mice Retinol and ascorbate drive erasure of epigenetic memory and enhance reprogramming to naïve pluripotency by complementary mechanisms Neuropeptide Y as a biomarker and therapeutic target for neuroblastoma Defective transcytosis of APP and lipoproteins in human iPSC-derived neurons with familial Alzheimer’s disease mutations Validation of a clinical-grade assay to measure donor-derived cell-free DNA in solid organ transplant recipients Nuclear receptors control pro-viral and antiviral metabolic responses to hepatitis C virus infection Stretchable materials for robust soft actuators towards assistive wearable devices Calcium intake from diet and supplements and the risk of coronary artery calcification and its progression among older adults: 10‐year follow‐up of the Multi‐Ethnic Study of Atherosclerosis (MESA) The p53 pathway controls SOX2-mediated reprogramming in the adult mouse spinal cord Selection-free genome editing of the sickle mutation in human adult hematopoietic stem/progenitor cells Aberrant IgA responses to the gut microbiota during infancy precede asthma and allergy development Circulating CXCR5 PD-1 ICOS follicular T helper cells are increased close to the diagnosis of type 1 diabetes in children with multiple autoantibodies The effect of oat β-glucan on LDL-cholesterol, non-HDL-cholesterol and apoB for CVD risk reduction: a systematic review and meta-analysis of randomised-controlled trials The potential health effects of dietary phytoestrogens Brain Modulyzer: interactive visual analysis of functional brain connectivity An excitatory cortical feedback loop gates retinal wave transmission in rodent thalamus Challenges and disparities in the application of personalized genomic medicine to populations with African ancestry Maternal milk T cells drive development of transgenerational Th1 immunity in offspring thymus Motor cortex activity predicts response alternation during sensorimotor decisions Cosmic radiation exposure and persistent cognitive dysfunction Intracortical microstimulation of human somatosensory cortex Bayesian model reveals latent atrophy factors with dissociable cognitive trajectories in Alzheimer’s disease Endoglin integrates BMP and Wnt signalling to induce haematopoiesis through JDP2 A LRRK2-dependent EndophilinA phosphoswitch is critical for macroautophagy at presynaptic terminals Measuring financial toxicity as a clinically relevant patient-reported outcome: The validation of the COmprehensive Score for financial Toxicity Probiotics, fiber and herbal medicinal products for functional and inflammatory bowel disorders Context processing and the neurobiology of post-traumatic stress disorder The structure of the antibiotic deactivating,N-hydroxylating Rifampicin Monooxygenase Mechanism of Rifampicin inactivation in Nocardia farcinica Extensive migration of young neurons into the infant human frontal lobe The calcium channel subunit alpha2delta2 suppresses axon regeneration in the adult CNS Restoring mucosal barrier function and modifying macrophage phenotype with an extracellular matrix hydrogel: potential therapy for ulcerative colitis Single-molecule imaging reveals that Rad4 employs a dynamic DNA damage recognition process Bacterial abscess formation is controlled by the stringent stress response and can be targeted therapeutically Spermidine suppresses age-associated memory impairment by preventing adverse increase of presynaptic active zone size and release 18F-AV-1451 tau PET imaging correlates strongly with tau neuropathology inMAPTmutation carriers Lack of P4H-TM in mice results in age-related retinal and renal alterations Chemotherapy-induced IL-34 enhances immunosuppression by tumor-associated macrophages and mediates survival of chemoresistant lung cancer cells TDP-43 stage, mixed pathologies, and clinical Alzheimer’s-type dementia Rho GTPase complementation underlies BDNF-dependent homo- and heterosynaptic plasticity Autocrine BDNF–TrkB signalling within a single dendritic spine Mycoplasma pneumoniaetriggering the Guillain-Barré syndrome: A case-control study Structure of myosin filaments from relaxed Lethocerus flight muscle by cryo-EM at 6 A resolution Preventative vaccines for Zika virus outbreak: preliminary evaluation Biomechanical and biochemical characterization of porcine tracheal cartilage Stimulation-based control of dynamic brain networks Discovery of a metastatic immune escape mechanism initiated by the loss of expression of the tumor biomarker interleukin-33 A global genetic interaction network maps a wiring diagram of cellular function The impact of endurance training on human skeletal muscle memory, global isoform expression and novel transcripts Preferential uptake of antioxidant carbon nanoparticles by T lymphocytes for immunomodulation Bacteriome and mycobiome interactions underscore microbial dysbiosis in familial Crohn’s disease Early-onset pediatric atopic dermatitis is TH2 but also TH17 polarized in skin Functional subclone profiling for prediction of treatment-induced intra-tumor population shifts and discovery of rational drug combinations in human glioblastoma Clinical outcomes of melanoma brain metastases treated with stereotactic radiosurgery and anti-PD-1 therapy, anti-CTLA-4 therapy, BRAF/MEK inhibitors, BRAF inhibitor, or conventional chemotherapy Leisure-time physical activity and the risk of suspected bacterial infections Virulence factors enhance Citrobacter rodentium expansion through aerobic respiration Turning the fate of reprogramming cells from retinal disorder to regeneration by Pax6 in newts Single-cell characterization of viral translation-competent reservoirs in HIV-infected individuals Integrative modeling reveals Annexin A2-mediated epigenetic control of mesenchymal glioblastoma Sertraline for preventing mood disorders following traumatic brain injury Beyond Krabbe's disease: The potential contribution of galactosylceramidase deficiency to neuronal vulnerability in late-onset synucleinopathies Bruton tyrosine kinase-dependent immune cell cross-talk drives pancreas cancer Macrophage PI3K drives pancreatic ductal adenocarcinoma progression PI3Kγ is a molecular switch that controls immune suppression Effects of abaloparatide-sc on fractures and bone mineral density in subgroups of postmenopausal women with osteoporosis and varying baseline risk factors Development of a three-dimensional bioengineering technology to generate lung tissue for personalized disease modeling Epigenome wide association study reveals differential DNA methylation in individuals with a history of myocardial infarction Effect of wearable technology combined with a lifestyle intervention on long-term weight loss: the IDEA randomized clinical trial Suppressor of cytokine signaling-1 (SOCS1) peptidomimetic limits progression of diabetic nephropathy Midlife physical activity and cognition later in life: a prospective twin study Detection of therapeutically targetable driver and resistance mutations in lung cancer patients by next generation sequencing of cell-free circulating tumor DNA Small molecule stabilization of the KSR inactive state antagonizes oncogenic Ras signalling Identification of altered metabolomic profiles following a Panchakarma-based Ayurvedic intervention in healthy subjects: the self-directed biological transformation initiative (SBTI) Mutational signatures of ionizing radiation in second malignancies Assessing intratumor heterogeneity and tracking longitudinal and spatial clonal evolutionary history by next-generation sequencing Single-molecule dissection of stacking forces in DNA Prefrontal responses to Stroop tasks in subjects with post-traumatic stress disorder assessed by functional near infrared spectroscopy Interplay between up-regulation of cytochrome-c-oxidase and hemoglobin oxygenation induced by near-infrared laser Synaptic mechanisms of pattern completion in the hippocampal CA3 network On-target efficacy of a HIF2α antagonist in preclinical kidney cancer models 3D porous graphene by low-temperature plasma welding for bone implants Dexamethasone and supportive care with or without whole brain radiotherapy in treating patients with non-small cell lung cancer with brain metastases unsuitable for resection or stereotactic radiotherapy (QUARTZ)... PRC2 enacts Wnt signaling in intestinal homeostasis and contributes to the instigation of stemness in diseases entailing epithelial hyperplasia or neoplasia The orphan nuclear receptor RORα and group 3 innate lymphoid cells drive fibrosis in a mouse model of Crohn’s disease Modulating neuronal competition dynamics in the dentate gyrus to rejuvenate aging memory circuits Conserved patterns hidden within group A Streptococcus M protein hypervariability recognize human C4b-binding protein Acquired resistance to combination treatment through loss of synergy with MEK and PI3K inhibitors in colorectal cancer Gut bacteria metabolism impacts immune recovery in HIV-infected individuals Loss of CHD1 causes DNA repair defects and enhances prostate cancer therapeutic responsiveness Pattern recognition with “materials that compute” CRISPR-Cas9 nuclear dynamics and target recognition in living cells Pathogenic shifts in endogenous microbiota impede tissue regeneration via distinct activation of TAK1/MKK/p38 Alpha-synuclein RT-QuIC in the CSF of patients with alpha-synucleinopathies A randomized, double-blind, placebo-controlled trial of low-dose sertraline in young children with fragile X syndrome Epigenetic profiling to classify cancer of unknown primary: a multicentre, retrospective analysis Low adoption of weight loss medications: A comparison of prescribing patterns of antiobesity pharmacotherapies and SGLT2s Patient attitudes toward telemedicine for diabetic retinopathy Recent evolution of the salivary mucin MUC7 Multi-organ mapping of cancer risk Altered proliferation and networks in neural cells derived from idiopathic autistic individuals Conformational dynamics of a G-protein α subunit is tightly regulated by nucleotide binding Safety and efficacy of vertebroplasty for acute painful osteoporotic fractures (VAPOUR): a multicentre, randomized, double-blind, placebo-controlled trial Relationship between antihypertensive medications and cognitive impairment: part II. review of physiology and animal studies Short term depression of gap junctional coupling in reticular thalamic neurons of absence epileptic rats IL-1β is an innate immune sensor of microbial proteolysis Genetic markers of pigmentation are novel risk loci for uveal melanoma Association of noninvasive quantitative decline in liver fat content on MRI with histologic response in nonalcoholic steatohepatitis Cell boundary elongation by non-autonomous contractility in cell oscillation Cellular resolution circuit mapping in mouse brain with temporal-focused excitation of soma-targeted channelrhodopsin Complete unique genome sequence, expression profile, and salivary gland tissue tropism of the herpesvirus 7 homolog in pigtailed macaques Biophysical insight into mechanisms of sonoporation Vascular stiffness mechanoactivates YAP/TAZ-dependent glutaminolysis to drive pulmonary hypertension PTRF/Cavin-1 promotes efficient ribosomal RNA transcription in response to metabolic challenges Magneto-aerotactic bacteria deliver drug-containing nanoliposomes to tumor hypoxic regions Targeted epigenetic remodeling of endogenous loci by CRISPR/Cas9-based transcriptional activators directly converts fibroblasts to neuronal cells Punctuated copy number evolution and clonal stasis in triple-negative breast cancer Cooperative unfolding of distinctive mechanoreceptor domains transduces force into signals A genome-editing strategy to treat β-hemoglobinopathies that recapitulates a mutation associated with a benign genetic condition Chemical genetic discovery of PARP targets reveals a role for PARP-1 in transcription elongation Balanced translocation linked to psychiatric disorder, glutamate, and cortical structure/function Risk and impact of pulmonary complications in survivors of childhood cancer: A report from the Childhood Cancer Survivor Study Active zone scaffolds differentially accumulate Unc13 isoforms to tune Ca2 channel–vesicle coupling Neurometabolic disorders: potentially treatable abnormalities in patients with treatment-refractory depression and suicidal behavior Stromal Hedgehog signaling is downregulated in colon cancer and its restoration restrains tumor growth Neurons in macaque area V4 are tuned for complex spatio-temporal patterns A conserved microRNA regulatory circuit is differentially controlled during limb/appendage regeneration Lectin-type oxidized LDL receptor-1 distinguishes population of human polymorphonuclear myeloid-derived suppressor cells in cancer patients The airway microbiome at birth Global distribution of businesses marketing stem cell-based interventions The evolution of epigenetics: from prokaryotes to humans and its biological consequences A dual molecular analogue tuner for dissecting protein function in mammalian cells Olfactory receptors modulate physiological processes in human airway smooth muscle cells OCT4 acts as an integrator of pluripotency and signal-induced differentiation The tumor microenvironment represses T cell mitochondrial biogenesis to drive intratumoral T cell metabolic insufficiency and dysfunction Curcumin sensitizes silymarin to exert synergistic anticancer activity in colon cancer cells Age-dependent niche signals from the choroid plexus regulate adult neural stem cells The macroecology of infectious diseases: a new perspective on global-scale drivers of pathogen distributions and impacts An integrated genomic and transcriptomic survey of mucormycosis-causing fungi A network of conserved synthetic lethal interactions for exploration of precision cancer therapy Non-centrosomal nucleation mediated by augmin organizes microtubules in post-mitotic neurons and controls axonal microtubule polarity Cdk5 disruption attenuates tumor PD-L1 expression and promotes antitumor immunity The rhesus monkey connectome predicts disrupted functional networks resulting from pharmacogenetic inactivation of the amygdala Spatial embedding and wiring cost constrain the functional layout of the cortical network of rodents and primates Dysfunctional epileptic neuronal circuits and dysmorphic dendritic spines are mitigated by platelet-activating factor receptor antagonism Comparison of ACC/AHA and ESC guideline recommendations following trial evidence for statin use in primary prevention of cardiovascular disease--results from the population-based rotterdam study Matrix-bound nanovesicles within ECM bioscaffolds Impact of volume change over time on trauma mortality in the United States Intra-tumor heterogeneity affects gene expression profile test prognostic risk stratification in early breast cancer An acellular biologic scaffold treatment for volumetric muscle loss: results of a 13-patient cohort study ER-mitochondria contacts couple mtDNA synthesis with mitochondrial division in human cells Template-dependent nucleotide addition in the reverse (3'-5') direction by Thg1-like protein Aurora kinase-induced phosphorylation excludes transcription factor RUNX from the chromatin to facilitate proper mitotic progression Valproic acid induces antimicrobial compound production in doratomyces microspores Automatic segmentation of Drosophila neural compartments using GAL4 expression data reveals novel visual pathways Heart failure after myocardial infarction is associated with increased risk of cancer In vivo bioorthogonal chemistry enables local hydrogel and systemic pro-drug to treat soft tissue sarcoma Design of a genetically stable high fidelity coxsackievirus B3 polymerase that attenuates virus growth in vivo Gray matter maturation and cognition in children with different APOEε genotypes An atomic model of HIV-1 capsid-SP1 reveals structures regulating assembly and maturation Extra-coding RNAs regulate neuronal DNA methylation dynamics The mitochondrial unfoldase-peptidase complex ClpXP controls bioenergetics stress and metastasis Adjuvant-dependent innate and adaptive immune signatures of risk of SIVmac251 acquisition Adaptive randomization of veliparib–carboplatin treatment in breast cancer Adaptive randomization of neratinib in early breast cancer Profiling of somatic mutations in acute myeloid leukemia with FLT3-ITD at diagnosis and relapse Pittsburgh Compound B imaging and cerebrospinal fluid amyloid-β in a multicentre European Memory Clinic study Worldwide trends in diabetes since 1980: a pooled analysis of 751 population-based studies with 4•4 million participants DNA demethylation of inflammasome-associated genes is enhanced in patients with cryopyrin-associated periodic syndromes Rapamycin suppresses microglial activation and reduces the development of neuropathic pain after spinal cord injury Defining the clonal dynamics leading to mouse skin tumor initiation Prevention of carcinogen-induced oral cancer by sulforaphane Does the cancer risk in colonic polyps unsuitable for polypectomy support the need for advanced endoscopic resections? Kataegis expression signature in breast cancer is associated with late onset, better prognosis, and higher HER2 levels Identification of lesion subtypes in biopsies of ductal carcinoma in situ of the breast using biomarker ratio imaging microscopy Visualization and analysis of gene expression in tissue sections by spatial transcriptomics Clinical relevance of brain atrophy assessment in multiple sclerosis. Implications for its use in a clinical routine A powerful CRISPR/Cas9-based method for targeted transcriptional activation Reengineering chimeric antigen receptor T cells for targeted therapy of autoimmune disease Pathology of congenital Zika syndrome in Brazil: a case series Electrical stimulation of visual cortex can immediately improve spatial vision Machine perfusion of donor livers for transplantation: a proposal for standardized nomenclature and reporting guidelines Longitudinal analysis of patient-reported outcomes and cosmesis in a randomized trial of conventionally fractionated versus hypofractionated whole-breast irradiation MetaFast: fast reference-free graph-based comparison of shotgun metagenomic data Hydroxyapatite coating on PEEK implants: biomechanical and histological study in a rabbit model Natural history of the infant gut microbiome and impact of antibiotic treatment on bacterial strain diversity and stability An engineered switch in T cell receptor specificity leads to an unusual but functional binding geometry Cost-effectiveness of percutaneous closure of the left atrial appendage in atrial fibrillation based on results from PROTECT AF versus PREVAIL Association of the extent of resection with survival in glioblastoma Microbial reconstitution reverses maternal diet-induced social and synaptic deficits in offspring Coarse-grained simulation reveals key features of HIV-1 capsid self-assembly Superresolution imaging reveals nanometer- and micrometer-scale spatial distributions of T-cell receptors in lymph nodes Multiplex enhancer-reporter assays uncover unsophisticated TP53 enhancer logic Tumour resistance in induced pluripotent stem cells derived from naked mole-rats Insulin-like growth factor-1 receptor deficiency in macrophages accelerates atherosclerosis and induces an unstable plaque phenotype in apolipoprotein E–deficient mice The development of spasmolytic polypeptide/TFF2-expressing metaplasia (SPEM) during gastric repair is absent in the aged stomach Microgeographic proteomic networks of the human colonic mucosa and their association with inflammatory bowel disease Acrolein is a pathogenic mediator of alcoholic liver disease and the scavenger hydralazine is protective in mice Shape transitions and chiral symmetry breaking in the energy landscape of the mitotic chromosome Reversal of cognitive decline in Alzheimer's disease Clinical outcomes of transplanted modified bone marrow-derived mesenchymal stem cells in stroke: a phase 1/2a study α-Synuclein binds to TOM20 and inhibits mitochondrial protein import in Parkinson’s disease Effect of a high-fat Mediterranean diet on bodyweight and waist circumference: a prespecified secondary outcomes analysis of the PREDIMED randomized controlled trial Development and validation of endovascular chemotherapy filter device for removing high-dose doxorubicin: preclinical study Identification of ETV6-RUNX1-like and DUX4-rearranged subtypes in paediatric B-cell precursor acute lymphoblastic leukaemia EGFR signal-network reconstruction demonstrates metabolic crosstalk in EMT Human glia can both induce and rescue aspects of disease phenotype in Huntington disease The risk of cancer with the use of recombinant human bone morphogenetic protein in spine fusion Inflammasome-dependent induction of adaptive NK cell memory Executive functioning and diabetes: The role of anxious arousal and inflammation An E3-ligase-based method for ablating inhibitory synapses Surgical therapies and tissue engineering: at the intersection between innovation and regulation Biosynthesis of a broad-spectrum nicotianamine-like metallophore in Staphylococcus aureus A diet mimicking fasting promotes regeneration and reduces autoimmunity and Multiple Sclerosis symptoms Enhanced sympathetic nerve activity induced by neonatal colon inflammation induces gastric hypersensitivity and anxiety-like behavior in adult rats Microbiota-derived phenylacetylglutamine associates with overall mortality and cardiovascular disease in patients with CKD Dysregulation of RBFOX2 is an early event in cardiac pathogenesis of diabetes A melanosomal two-pore sodium channel regulates pigmentation Evidence for the role of microRNA 374b in acquired cisplatin resistance in pancreatic cancer cells Nicotinamide riboside opposes type 2 diabetes and neuropathy in mice A cholesterol-based allostery model of T cell receptor phosphorylation Zika virus infects human placental macrophages Simultaneous scalp, skull, kidney, and pancreas transplant from a single donor Na+ influx induced by new antimalarials causes rapid alterations in the cholesterol content and morphology of Plasmodium falciparum A neuronal culture system to detect prion synaptotoxicity Neuronal hyperactivity disturbs ATP microgradients, impairs microglial motility, and reduces phagocytic receptor expression triggering apoptosis/microglial phagocytosis uncoupling Additional measurement of hCG distinguishes physiological high-normal thyroid function and reveals large differences in the risk of developing preeclampsia Atrial arrhythmias after lung transplantation: Incidence and risk factors in 652 lung transplant recipients A new method for preparing mesenchymal stem cells and labeling with Ferumoxytol for cell tracking by MRI Effector T cells abrogate stroma-mediated chemoresistance in ovarian cancer Intensive vs standard blood pressure control and cardiovascular disease outcomes in adults aged ≥75 years Combined treatment with epigenetic, differentiating, and chemotherapeutic agents cooperatively targets tumor-initiating cells in triple-negative breast cancer Medical device approvals through the premarket approval pathway in obstetrics and gynecology from 2000 to 2015 Development of a 3D printed, bioengineered placenta model to evaluate the role of trophoblast migration in preeclampsia Metabolic engineering of light-driven cytochrome P450 dependent pathways into Synechocystis sp. PCC 6803 The preventability of cancer: stacking the deck Preventable incidence and mortality of carcinoma associated with lifestyle factors among white adults in the United States A role for HOX13 proteins in the regulatory switch between TADs at the HoxD locus Visual impairment and blindness in adults in the United States Utilizing the dog genome in the search for novel candidate genes involved in glioma development—genome wide association mapping followed by targeted massive parallel sequencing identifies a strongly associated locus Fusion peptide of HIV-1 as a site of vulnerability to neutralizing antibody Histone H3K36 mutations promote sarcomagenesis through altered histone methylation landscape Sitagliptin versus placebo in the treatment of nonalcoholic fatty liver disease: A randomized controlled trial High lipoprotein(a) as a possible cause of clinical familial hypercholesterolaemia: a prospective cohort study Greater hippocampal volume is associated with PTSD treatment response Fc-receptor polymorphisms, cetuximab therapy, and survival in the NCIC CTG CO.17 trial of colorectal cancer Bioengineered human acellular vessels for dialysis access in patients with end-stage renal disease: two phase 2 single-arm trials Preliminary intraoperative validation of the nociception level index Pharmacogenetic discovery in CALGB (Alliance) 90401 and mechanistic validation of a VAC14 polymorphism that increases risk of docetaxel-induced neuropathy Subconcussive head trauma and near point of convergence Association of football subconcussive head impacts with ocular near point of convergence Nutritional supplementation to reduce child aggression: a randomized, stratified, single-blind, factorial trial A human genome-wide loss-of-function screen identifies effective chikungunya antiviral drugs Molecular mechanism of anesthetic-induced depression of myocardial contraction Adult NG2-glia are required for median eminence-mediated leptin sensing and body weight control Plasma biomarker analysis in pediatric ARDS: generating future framework from a pilot randomized control trial of methylprednisolone: a framework for identifying plasma biomarkers related to clinical outcomes in pediatric ARDS Apolipoprotein E4 causes age-dependent disruption of slow gamma oscillations during hippocampal sharp-wave ripples Simultaneous antibiofilm and antiviral activities of an engineered antimicrobial peptide during virus-bacterium coinfection Real-time quantification of single RNA translation dynamics in living cells DNA-based nanoparticle tension sensors reveal that T-cell receptors transmit defined pN forces to their antigens for enhanced fidelity Developmental acquisition of regulomes underlies innate lymphoid cell functionality Climate change and the emergent epidemic of CKD from heat stress in rural communities: the case for heat stress nephropathy Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein Gene-microbiota interactions contribute to the pathogenesis of inflammatory bowel disease Impact of maternal glucose and gestational weight gain on child obesity over the first decade of life in normal birth weight infants Higher C-reactive protein levels predict postoperative delirium in older patients undergoing major elective surgery: a longitudinal nested case-control study Zika virus depletes neural progenitors in human cerebral organoids through activation of the innate immune receptor TLR3 Rapid, low-cost detection of Zika virus using programmable biomolecular components Defects in neuromuscular transmission may underlie motor dysfunction in spinal and bulbar muscular atrophy Minihepcidin peptides as disease modifiers in mice affected by beta-thalassemia and polycythemia vera Evaluation of a portable artificial vision device among patients with low vision Bioresorbable silicon electronics for transient spatiotemporal mapping of electrical activity from the cerebral cortex Mapping an index of the myelin g-ratio in infants using magnetic resonance imaging The Clinical Research Office of the Endourological Society (CROES) multicentre randomised trial of narrow band imaging–assisted transurethral resection of bladder tumour (TURBT) versus conventional white light imaging–assisted TURBT in primary Slx5/Slx8 promotes replication stress tolerance by facilitating mitotic progression Chemical control of grafted human PSC-derived neurons in a mouse model of Parkinson’s Disease Sp7/Osterix is restricted to bone-forming vertebrates where it acts as a Dlx co-factor in osteoblast specification Phenotypically distinct subtypes of psychosis accompany novel or rare variants in four different signaling genes Regulators of metastasis modulate the migratory response to cell contact under spatial confinement Factors associated with injurious falls in residential care facilities Prioritizing variants in complete hereditary breast and ovarian cancer (HBOC) genes in patients lacking known BRCA mutations A unified analytic framework for prioritization of non-coding variants of uncertain significance in heritable breast and ovarian cancer Optical fiber LPG biosensor integrated microfluidic chip for ultrasensitive glucose detection Airway bacteria drive a progressive COPD-like phenotype in mice with polymeric immunoglobulin receptor deficiency Age-dependent pancreatic gene regulation reveals mechanisms governing human β cell function Residential radon exposure and risk of incident hematologic malignancies in the Cancer Prevention Study-II Nutrition Cohort Tight junction protein 1 modulates proteasome capacity and proteasome inhibitor sensitivity in multiple myeloma via EGFR/JAK1/STAT3 signaling Predictive features of ligand-specific signaling through the estrogen receptor Interfacial geometry dictates cancer cell tumorigenicity NAD repletion improves mitochondrial and stem cell function and enhances lifespan in mice RNA splicing is a primary link between genetic variation and disease Regulators of metastasis modulate the migratory response to cell contact under spatial confinement Insulin signaling misregulation underlies circadian and cognitive deficits in a Drosophila fragile X model Minimally invasive screening for colitis using attenuated total internal reflectance fourier transform infrared spectroscopy Crystal structure of the prefusion surface glycoprotein of the prototypic arenavirus LCMV Development and validation of a new prognostic system for patients with hepatocellular carcinoma Fatty liver is an independent predictor of early carotid atherosclerosis From sample to multi-omics conclusions in under 48 hours Disentangling the association between statins, cholesterol, and colorectal cancer: a nested case-control study Limit cycle oscillations in standing human posture Retinal neurodegeneration may precede microvascular changes characteristic of diabetic retinopathy in diabetes mellitus Efficient total syntheses and biological activities of two teixobactin analogues Fracture healing: a consensus report from the International Osteoporosis Foundation Fracture Working Group Will they participate? predicting patients’ response to clinical trial invitations in a pediatric emergency department Intrauterine inflammation and maternal exposure to ambient PM2.5 during preconception and specific periods of pregnancy: the Boston birth cohort Twist1 induces distinct cell states depending on TGFBR1-activation Exosomal microRNA miR-92a concentration in serum reflects human brown fat activity Bacterial superglue enables easy development of efficient virus-like particle based vaccines A reservoir of mature cavity macrophages that can rapidly invade visceral organs to affect tissue repair Percutaneous lymphatic embolization of abnormal pulmonary lymphatic flow as treatment of plastic bronchitis in patients with congenital heart disease clinical perspective Prolonged sleep restriction induces changes in pathways involved in cholesterol metabolism and inflammatory responses Hobit and Blimp1 instruct a universal transcriptional program of tissue residency in lymphocytes The CRISPR-associated DNA-cleaving enzyme Cpf1 also processes precursor CRISPR RNA Structural insights into the transport mechanism of the human sodium-dependent lysophosphatidylcholine transporter Mfsd2a Magnifying smartphone screen using Google glass for low-vision users Serum zinc concentration and C-reactive protein in individuals with human immunodeficiency virus infection: the positive living with HIV (POLH) study The molecular basis of the genesis of basal tone in internal anal sphincter The necrosome promotes pancreatic oncogenesis via CXCL1 and Mincle-induced immune suppression Experimental treatment of Ebola virus disease with TKM-130803: a single-arm phase 2 clinical trial Hypoxia regulates global membrane protein endocytosis through caveolin-1 in cancer cells An endogenous caspase-11 ligand elicits interleukin-1 release from living dendritic cells Primary prevention of cardiovascular disease in older adults Multiscale origami structures as interface for cells Competition between jagged-notch and endothelin1 signaling selectively restricts cartilage formation in the zebrafish upper face Brain-region-specific organoids using mini-bioreactors for modeling ZIKV exposure Liver preservation with machine perfusion and a newly developed cell-free oxygen carrier solution under subnormothermic conditions Blue light reduces organ injury from ischemia and reperfusion Genetic lineage tracing identifies endocardial origin of liver vasculature Cholesterol analogs with degradation-resistant alkyl side chains are effective mycobacterium tuberculosis growth inhibitors Novel 3D magnetic resonance elastography for the noninvasive diagnosis of advanced fibrosis in NAFLD: a prospective study Population-based epidemiology and mortality of small malignant gastrointestinal stromal tumors in the USA Epidermal growth factor suppresses intestinal epithelial cell shedding via a MAPK dependent pathway Clinical exome sequencing in neurologic disease Worldwide trends in diabetes since 1980: a pooled analysis of 751 population-based studies with 4•4 million participants SOD-mimetic M40403 is protective in cell and fly models of paraquat toxicity: implications for Parkinson disease Modulation of tissue repair by regeneration enhancer elements Cortical contributions to the auditory frequency-following response revealed by MEG Long antibody HCDR3s from HIV-naïve donors presented on a PG9 neutralizing antibody background mediate HIV neutralization X-ray structures and mechanism of the human serotonin transporter Silicon nitride bioceramics induce chemically driven lysis in Porphyromonas gingivalis Chimeric 2C10R4 anti-CD40 antibody therapy is critical for long-term survival of GTKO.hCD46.hTBM pig-to-primate cardiac xenograft TAM receptors regulate multiple features of microglial physiology Developing an animal model of Dupuytren’s disease by orthotopic transplantation of human fibroblasts into athymic rat Change in pain and physical function following bariatric surgery for severe obesity Visualizing allele-specific expression in single cells reveals epigenetic mosaicism in anH19loss-of-imprinting mutant 3,5-Bis(3-alkylaminomethyl-4-hydroxybenzylidene)-4-piperidones: a novel class of potent tumor-selective cytotoxins Parameter selection and verification techniques based on global sensitivity analysis illustrated for an HIV model Role of p53, mitochondrial DNA deletions, and paternal age in autism: a case-control study Development of the Biopen: a handheld device for surgical printing of adipose stem cells at a chondral wound site Blocking synaptic removal of GluA2-containing AMPA receptors prevents the natural forgetting of long-term memories Steric trapping reveals a cooperativity network in the intramembrane protease GlpG Impact of prostate-specific antigen (PSA) screening trials and revised PSA screening guidelines on rates of prostate biopsy and postbiopsy complications Familial autoinflammation with neutrophilic dermatosis reveals a regulatory mechanism of pyrin activation Voluntary imitation in Alzheimer’s disease patients Methionine and kynurenine activate oncogenic kinases in glioblastoma, and methionine deprivation compromises proliferation Type I bHLH proteins Daughterless and Tcf4 restrict neurite branching and synapse formation by repressing neurexin in postmitotic neurons Effective implementation of health information technologies in U.S. hospitals Hedgehog pathway inhibition Body temperature regulation in diabetes Experimental inhibition of porcupine-mediated Wnt O-acylation attenuates kidney fibrosis Application of fluorescent protein expressing strains to evaluation of anti-tuberculosis therapeutic efficacy in vitro and in vivo Large-scale imaging of cortical dynamics during sensory perception and behavior Sequence features accurately predict genome-wide MeCP2 binding in vivo Frequency and complexity of de novo structural mutation in autism GABAergic neuron-specific loss of Ube3a causes angelman syndrome-like EEG abnormalities and enhances seizure susceptibility Leptin controls parasympathetic wiring of the pancreas during embryonic life Heterogeneity in Oct4 and Sox2 targets biases cell fate in 4-cell mouse embryos Lysosomal disorders drive susceptibility to tuberculosis by compromising macrophage migration Enhanced cancer immunotherapy by microneedle patch-assisted delivery of anti-PD1 antibody A pH-driven transition of the cytoplasm from a fluid- to a solid-like state promotes entry into dormancy A multicenter observational study of incretin-based drugs and heart failure Curcumin enhances human macrophage control of Mycobacterium tuberculosis infection Staphylococcus aureus toxin potentiates opportunistic bacterial lung infections Primary cilium-autophagy-Nrf2 (PAN) axis activation commits human embryonic stem cells to a neuroectoderm fate Harnessing surface-bound enzymatic reactions to organize microcapsules in solution ECM hydrogel for the treatment of stroke: Characterization of the host cell infiltrate Integrative single-cell transcriptomics reveals molecular networks defining neuronal maturation during postnatal neurogenesis Gastric bypass surgery vs intensive lifestyle and medical intervention for type 2 diabetes: the CROSSROADS randomised controlled trial Ethnicity and prevalence of multiple sclerosis in east London Neuregulin-1 controls an endogenous repair mechanism after spinal cord injury Ultrasensitive antibody detection by agglutination-PCR (ADAP) GT198 expression defines mutant tumor stroma in human breast cancer Spinal cord stimulation (SCS) and functional magnetic resonance imaging (fMRI): modulation of cortical connectivity with therapeutic SCS Immune-responsive gene 1 protein links metabolism to immunity by catalyzing itaconic acid production Pro-inflammatory macrophages sustain pyruvate oxidation through pyruvate dehydrogenase for the synthesis of itaconate and to enable cytokine expression Metagenomic sequencing with strain-level resolution implicates uropathogenic E. coli in necrotizing enterocolitis and mortality in preterm infants Diurnal salivary cortisol patterns prior to pregnancy predict infant birth weight Phase-selective entrainment of nonlinear oscillator ensembles Effects of oral contraceptive use on anterior cruciate ligament injury epidemiology Contrast-enhanced optical coherence tomography with picomolar sensitivity for functional in vivo imaging Generation and transplantation of reprogrammed human neurons in the brain using 3D microtopographic scaffolds Intestinal interleukin-17 receptor signaling mediates reciprocal control of the gut microbiota and autoimmune inflammation Preoperative prealbumin level as a risk factor for surgical site infection following elective spine surgery Mating-induced transcriptome changes in the reproductive tract of female Aedes aegypti The effect of treatment of obstructive sleep apnea on glycemic control in type 2 diabetes Structure- and function-based design of Plasmodium-selective proteasome inhibitors Endolysosomal trafficking of viral G protein-coupled receptor functions in innate immunity and control of viral oncogenesis A broad RNA virus survey reveals both miRNA dependence and functional sequestration Declining bowel cancer incidence and mortality in Germany—an analysis of time trends in the first ten years after the introduction of screening colonoscopy Lack of TRPV2 impairs thermogenesis in mouse brown adipose tissue Snoo and Dpp act as spatial and temporal regulators respectively of adult progenitor cells in the Drosophila trachea Surprising lack of liposome-induced complement activation by artificial 1,3-diamidophospholipids in vitro Diagnostic screening for subclinical celiac disease using a rapid test in children aged 2–4 Individualized statin benefit for determining statin eligibility in the primary prevention of cardiovascular disease ACEMg diet supplement modifies progression of hereditary deafness Structural health monitoring (vibration) as a tool for identifying structural alterations of the lumbar spine: a twin control study Drug harms in the UK: a multicriteria decision analysis Longitudinal relationships between caloric expenditure and gray matter in the cardiovascular health study Incidence and risk factors for food hypersensitivity in UK infants: results from a birth cohort study Weekly vs. every-3-week paclitaxel and carboplatin for ovarian cancer Structural hot spots for the solubility of globular proteins NF-κB restricts inflammasome activation via elimination of damaged mitochondria Functional segregation of cortical regions underlying speech timing and articulation Age-dependent decrease of mitochondrial complex II activity in human skin fibroblasts Bariatric surgery and emergency department visits and hospitalizations for heart failure exacerbation Perineural expression of high-mobility group box-1 contributes to long-lasting mechanical hypersensitivity via matrix metalloprotease-9 up-regulation in mice with painful peripheral neuropathy Hypothalamic leptin action is mediated by histone deacetylase 5 Targeting p38 or MK2 enhances the anti-leukemic activity of smac-mimetics Down syndrome developmental brain transcriptome reveals defective oligodendrocyte differentiation and myelination Anaplasmataceae-specific PCR for diagnosis and therapeutic guidance for symptomatic Neoehrlichiosis in immunocompetent host Stem cell and neurogenic gene-expression profiles link prostate basal cells to aggressive prostate cancer Prognostic impact of modulators of G proteins in circulating tumor cells from patients with metastatic colorectal cancer Skin redox balance maintenance: the need for an Nrf2-activator delivery system Constitutive modeling of ascending thoracic aortic aneurysms using microstructural parameters Distinct structural pathways coordinate the activation of AMPA receptor-auxiliary subunit complexes Association between objectively measured physical activity and mortality in NHANES The BENEFIT trial: where do we go from here? Strong components of epigenetic memory in cultured human fibroblasts related to site of origin and donor age Positional proteomics reveals differences in N-terminal proteoform stability Structural and molecular basis for Ebola virus neutralization by protective human antibodies Protective monotherapy against lethal Ebola virus infection by a potent neutralizing antibody Metabolomics-based discovery of small molecule biomarkers in serum associated with dengue virus infections and disease outcomes Complete meiosis from embryonic stem cell-derived germ cells in vitro Fluorescent false neurotransmitter reveals functionally silent dopamine vesicle clusters in the striatum Self-induced switchings between multiple space–time patterns on complex networks of excitable units A 3D bioprinting system to produce human-scale tissue constructs with structural integrity Convective flow reversal in self-powered enzyme micropumps The third international consensus definitions for sepsis and septic shock (sepsis-3) A framework for the development and interpretation of different sepsis definitions and clinical criteria Feasibility and safety of low-flow extracorporeal carbon dioxide removal to facilitate ultra-protective ventilation in patients with moderate acute respiratory distress syndrome Feasibility and safety of low-flow extracorporeal carbon dioxide removal to facilitate ultra-protective ventilation in patients with moderate acute respiratory distress syndrome Dental pulp stem cells: a new cellular resource for corneal stromal regeneration Monodispersed calcium carbonate nanoparticles modulate local pH and inhibit tumor growth in vivo RNA hairpin folding in the crowded cell Correlated magnetic resonance imaging and ultramicroscopy (MR-UM) is a tool kit to assess the dynamics of glioma angiogenesis The role of risk-reducing surgery in hereditary breast and ovarian cancer Effect of acetazolamide vs placebo on duration of invasive mechanical ventilation among patients with chronic obstructive pulmonary disease: a randomized clinical trial Uncovering Listeria monocytogenes hypervirulence by harnessing its biodiversity Chronic ampakine treatments stimulate dendritic growth and promote learning in middle-aged rats Intracellular mGluR5 plays a critical role in neuropathic pain Collagen and heparan sulfate coatings differentially alter cell proliferation and attachment in vitro and in vivo MLL1 is essential for the senescence-associated secretory phenotype Rapid dry-reagent immunomagnetic biosensing platform based on volumetric detection of nanoparticles on 3D structures The kinetochore prevents centromere-proximal crossover recombination during meiosis Divergent associations of height with cardiometabolic disease and cancer: epidemiology, pathophysiology, and global implications Innate lymphoid cells are depleted irreversibly during acute HIV-1 infection in the absence of viral suppression Are the symptoms of calcific tendinitis due to neoinnervation and/or neovascularization? The root extract of the medicinal plant Pelargonium sidoides is a potent HIV-1 attachment inhibitor Potent in vitro antiviral activity of Cistus incanus extract against HIV and Filoviruses targets viral envelope proteins Principles governing the self-assembly of coiled-coil protein nanoparticles 5-azacytidine enhances the mutagenesis of HIV-1 by reduction to 5-aza-2’-deoxycytidine Endomucin prevents leukocyte–endothelial cell adhesion and has a critical role under resting and inflammatory conditions MYB-QKI rearrangements in angiocentric glioma drive tumorigenicity through a tripartite mechanism Functional malignant cell heterogeneity in pancreatic neuroendocrine tumors revealed by targeting of PDGF-DD Adenosine deaminase regulates Treg expression in autologous T cell-dendritic cell cocultures from patients infected with HIV-1 Acute changes in striatal microstructure predict the development of interferon-alpha induced fatigue Highly robust crystalsome via directed polymer crystallization at curved liquid/liquid interface SHARPIN controls regulatory T cells by negatively modulating the T cell antigen receptor complex Anthropogenic radio-frequency electromagnetic fields elicit neuropathic pain in an amputation model Neural bases of orthographic long-term memory and working memory in dysgraphia Understanding the association between chronic obstructive pulmonary disease and current anxiety: a population-based study Timing of expression of the core clock gene Bmal1 influences its effects on aging and survival Reduction of aberrant NF-κB signalling ameliorates Rett syndrome phenotypes in Mecp2-null mice On-chip construction of liver lobule-like microtissue and its application for adverse drug reaction assay Non-catalytic roles for XPG with BRCA1 and BRCA2 in homologous recombination and genome stability Cre-dependent selection yields AAV variants for widespread gene transfer to the adult brain Copper delivery to the CNS by CuATSM effectively treats motor neuron disease in SODG93A mice co-expressing the copper-chaperone-for-SOD Sustained Akt activity is required to maintain cell viability in seborrheic keratosis, a benign epithelial tumor Non-CG DNA methylation is a biomarker for assessing endodermal differentiation capacity in pluripotent stem cells Genome-wide nucleosome specificity and function of chromatin remodellers in ES cells Life span extension by targeting a link between metabolism and histone acetylation in Drosophila Post-translational control of the temporal dynamics of transcription factor activity regulates neurogenesis High-resolution wavefront shaping with a photonic crystal fiber for multimode fiber imaging Novel Wnt regulator NEL-like molecule-1 antagonizes adipogenesis and augments osteogenesis induced by bone morphogenetic protein 2 Safety and efficacy of plasmid DNA expressing two isoforms of hepatocyte growth factor in patients with critical limb ischemia Differential toxicity of antibodies to the prion protein Trim28 haploinsufficiency triggers bi-stable epigenetic obesity Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases Are we really vastly outnumbered? Revisiting the ratio of bacterial to host cells in humans Spontaneous decoding of the timing and content of human object perception from cortical surface recordings reveals complementary information in the event-related potential and broadband spectral change Lipofilling of the breast does not increase the risk of recurrence of breast cancer An unprecedented mechanism of nucleotide methylation in organisms containing thyX Cell-type-specific control of brainstem locomotor circuits by basal ganglia Pathway-specific remodeling of thalamostriatal synapses in Parkinsonian mice Systemic administration of the apocarotenoid bixin protects skin against solar UV-induced damage through activation of NRF2 DNA methylation outliers in normal breast tissue identify field defects that are enriched in cancer Computational modeling of oscillating fins that “catch and release” targeted nanoparticles in bilayer flows Blimp-1 controls plasma cell function through the regulation of immunoglobulin secretion and the unfolded protein response Multifunctional role of the transcription factor Blimp-1 in coordinating plasma cell differentiation Acute myeloid leukemia requires Hhex to enable PRC2-mediated epigenetic repression ofCdkn2a Predicting the risk of malignancy in adnexal masses based on the Simple Rules from the International Ovarian Tumor Analysis (IOTA) group Transcriptomic analysis of the host response and innate resilience to enterotoxigenic Escherichia coli infection in humans Bone microarchitecture in men and women with diabetes: the importance of cortical porosity Autonomous beating rate adaptation in human stem cell-derived cardiomyocytes Association of asymptomatic bradycardia with incident cardiovascular disease and mortality: the multi-ethnic study of atherosclerosis (MESA) Plug-and-display: decoration of virus-like particles via isopeptide bonds for modular immunization Selective integrin endocytosis is driven by interactions between the integrin α-chain and AP2 Lactoferrin acts as an adjuvant during influenza vaccination of neonatal mice Vitamin B12 status in older adults living in Ontario long-term care homes: prevalence and incidence of deficiency with supplementation as a protective factor COMT and OPRM1 genotype associations with daily knee pain variability and activity induced pain Nanoscale visualization of functional adhesion/excitability nodes at the intercalated disc Sustained correction of FVII deficiency in dogs using AAV-mediated expression of zymogen FVII Bioresorbable silicon electronic sensors for the brain Functional genomic landscape of human breast cancer drivers, vulnerabilities, and resistance Functionalization of C(sp3)-H bonds using a transient directing group Reconfigurable chiroptical nanocomposites with chirality transfer from the macro- to the nanoscale Lysyl oxidase is associated with increased thrombosis and platelet reactivity WNT-SHH antagonism specifies and expands stem cells prior to niche formation Bicarbonate concentration, acid-base status, and mortality in the health, aging, and body composition study Local and global consequences of flow on bacterial quorum sensing High Kellgren-Lawrence grade and bone marrow lesions predict worsening rates of radiographic joint space narrowing; the SEKOIA study Obesity-induced colorectal cancer is driven by caloric silencing of the guanylin-GUCY2C paracrine signaling axis TNF drives monocyte dysfunction with age and results in impaired anti-pneumococcal immunity Fiber and saturated fat are associated with sleep arousals and slow wave sleep Astrocytes assemble thalamocortical synapses by bridging NRX1α and NL1 via hevin AMP-activated protein kinase mediates mitochondrial fission in response to energy stress Functional reorganization and prediction of motor recovery after a stroke: A graph theoretical analysis of functional networks Development of exosome-encapsulated paclitaxel to overcome MDR in cancer cells Objectively-measured sedentary time and cardiometabolic health in adults with severe obesity Shared genetic predisposition in peripartum and dilated cardiomyopathies Secreted factors from human vestibular schwannomas can cause cochlear damage Proxy measures of vitamin D status – season and latitude – correlate with adverse outcomes after bariatric surgery in the Nationwide Inpatient Sample, 2001–2010: a retrospective cohort study Prevention of premature menopause and preservation of fertility in young cancer survivors: hopeful though modest long-term results Ovarian suppression with triptorelin during adjuvant breast cancer chemotherapy and long-term ovarian function, pregnancies, and disease-free survival: a randomized clinical trial Transient acute kidney injury in the postoperative period: it is time to pay closer attention Cardiovascular-specific mortality and kidney disease in patients undergoing vascular surgery In vivo imaging of inflammasome activation reveals a subcapsular macrophage burst response that mobilizes innate and adaptive immunity YAP is a critical inducer of SOCS3, preventing reactive astrogliosis Organic and inorganic mercurials have distinct effects on cellular thiols, metal homeostasis, and Fe-binding proteins in Escherichia coli Visualization of bacterial microcompartment facet assembly using high-speed atomic force microscopy Warning symptoms are associated with survival from sudden cardiac arrest In situ vaccination with cowpea mosaic virus nanoparticles suppresses metastatic cancer Abnormal cell-intrinsic and network excitability in the neocortex of serotonin-deficient Pet-1 knock-out mice Phosphorylation of the chromatin remodeling factor DPF3a induces cardiac hypertrophy through releasing HEY repressors from DNA In vivo single-particle imaging of nuclear mRNA export in budding yeast demonstrates an essential role for Mex67p Patterns and functional implications of rare germline variants across 12 cancer types Toll-like receptor 4–mediated lymphocyte influx induces neonatal necrotizing enterocolitis Phosphorylation-mediated RNA/peptide complex coacervation as a model for intracellular liquid organelles Sepsis induces long-term metabolic and mitochondrial muscle stem cell dysfunction amenable by mesenchymal stem cell therapy Aerobic fitness in late adolescence and the risk of early death: a prospective cohort study of 1.3 million Swedish men Extreme vulnerability of IDH1 mutant cancers to NAD+ depletion Targeted killing of virally infected cells by radiolabeled antibodies to viral proteins A fully human antibody to gp41 selectively eliminates HIV-infected cells that transmigrated across a model human blood brain barrier SerpinB1 promotes pancreatic β cell proliferation Electronic enhancement of tear secretion Analytic models of oxygen and nutrient diffusion, metabolism dynamics, and architecture optimization in three-dimensional tissue constructs with applications and insights in cerebral organoids Long-term outcome of a phase II trial using immunomodulatory in situ gene therapy in combination with intensity-modulated radiotherapy with or without hormonal therapy in the treatment of prostate cancer Dnmt3a2: a hub for enhancing cognitive functions Skeletal muscle and pediatric bone development A cellular system for spatial signal decoding in chemical gradients Non-lethal inhibition of gut microbial trimethylamine production for the treatment of atherosclerosis A human 3′UTR clone collection to study post-transcriptional gene regulation Enhanced phasic GABA inhibition during the repair phase of stroke: a novel therapeutic target The human pancreas as a source of protolerogenic extracellular matrix scaffold for a new-generation bioartificial endocrine pancreas Valsartan/Sacubitril for heart failure reconciling disparities between preclinical and clinical investigations Single-molecule view of basal activity and activation mechanisms of the G protein-coupled receptor β2AR Identification of an immunodominant peptide from citrullinated tenascin-C as a major target for autoantibodies in rheumatoid arthritis Self-assembled RNA-triple-helix hydrogel scaffold for microRNA modulation in the tumour microenvironment Neuropathic ocular pain due to dry eye is associated with multiple comorbid chronic pain syndromes Recruitment of classical monocytes can be inhibited by disturbing heteromers of neutrophil HNP1 and platelet CCL5 Subtle CXCR3-dependent chemotaxis of CTLs within infected tissue allows efficient target localization Oxygen enhanced MRI accurately identifies, quantifies, and maps hypoxia in preclinical cancer models Re-opening the critical window for estrogen therapy Hif-1α and Hif-2α synergize to suppress AML development but are dispensable for disease maintenance Purification and characterization of progenitor and mature human astrocytes reveals transcriptional and functional differences with mouse PTH induces systemically administered mesenchymal stem cells to migrate to and regenerate spine injuries Topological analyses in APP/PS1 mice reveal that astrocytes do not migrate to amyloid-β plaques Delayed rod-mediated dark adaptation is a functional biomarker for incident early age-related macular degeneration Detection of aberrant hippocampal mossy fiber connections: Ex vivo mesoscale diffusion MRI and microtractography with histological validation in a patient with uncontrolled temporal lobe epilepsy Dystrophin expression in muscle stem cells regulates their polarity and asymmetric division AAV gene transfer delays disease onset in a TPP1-deficient canine model of the late infantile form of Batten disease Simultaneous reprogramming and gene correction of patient fibroblasts Human induced pluripotent stem cell–derived podocytes mature into vascularized glomeruli upon experimental transplantation rAAV-CFTRΔR rescues the cystic fibrosis phenotype in human intestinal organoids and CF mice Panretinal photocoagulation vs intravitreous ranibizumab for proliferative diabetic retinopathy The bioenergetic costs of a gene C. elegans maximum velocity correlates with healthspan and is maintained in worms with an insulin receptor mutation Cell type–specific abundance of 4EBP1 primes prostate cancer sensitivity or resistance to PI3K pathway inhibitors Self-assembled 20-nm 64Cu-micelles enhance accumulation in rat glioblastoma Super natural killer cells that target metastases in the tumor draining lymph nodes Red blood cell dysfunction induced by high-fat diet Combining suppression of stemness with lineage-specific induction leads to conversion of pluripotent cells into functional neurons Prediction of drug-induced nephrotoxicity and injury mechanisms with human induced pluripotent stem cell-derived cells and machine learning methods Transcriptional landscape of cardiomyocyte maturation Extremely high genetic diversity in a single tumor points to prevalence of non-Darwinian cell evolution Harnessing cellular-derived forces in self-assembled microtissues to control the synthesis and alignment of ECM Structural stability and local dynamics in disease-causing mutants of human apolipoprotein A-I: what makes the protein amyloidogenic? MicroRNA expression profiling of human blood monocyte subsets highlights functional differences RNA-seq of tumor-educated platelets enables blood-based pan-cancer, multiclass, and molecular pathway cancer diagnostics Mining retrospective data for virtual prospective drug repurposing: L-DOPA and age-related macular degeneration Unproven stem cell–based interventions and achieving a compromise policy among the multiple stakeholders A 3′ poly(A) tract is required for LINE-1 retrotransposition Dynamics of cell generation and turnover in the human heart No evidence for cardiomyocyte number expansion in preadolescent mice Modeling of autosomal-dominant retinitis pigmentosa in Caenorhabditis elegans uncovers a nexus between global impaired functioning of certain splicing factors and cell type-specific apoptosis Inhibition of cyclooxygenase-2 in hematopoietic cells results in salt-sensitive hypertension Systemic treatment with a 5HT1a agonist induces anti-oxidant protection and preserves the retina from mitochondrial oxidative stress Iroquois proteins promote skeletal joint formation by maintaining chondrocytes in an immature state Generation of an expandable intermediate mesoderm restricted progenitor cell line from human pluripotent stem cells GFP-specific CD8 T cells enable targeted cell depletion and visualization of T-cell interactions A chromatin-independent role of Polycomb-like 1 to stabilize p53 and promote cellular quiescence Rare variants in cardiomyopathy genes associated with stress-induced cardiomyopathy Definition of a consensus integrin adhesome and its dynamics during adhesion complex assembly and disassembly Identifying an ovarian cancer cell hierarchy regulated by bone morphogenetic protein 2 Endogenous opioids contribute to insensitivity to pain in humans and mice lacking sodium channel Nav1.7 Differentiation of human ESCs to retinal ganglion cells using a CRISPR engineered reporter cell line De novo mutations in congenital heart disease with neurodevelopmental and other congenital anomalies Ultrasound ablation enhances drug accumulation and survival in mammary carcinoma models HIP1 is an early-stage prognostic biomarker of lung adenocarcinoma and suppresses metastasis via Akt-mediated EMT Efficient test and visualization of multi-set intersections Multiscale embedded gene co-expression network analysis Hydrogels with tunable stress relaxation regulate stem cell fate and activity Multinucleated giant cells are specialized for complement-mediated phagocytosis and large target destruction Estriol combined with glatiramer acetate for women with relapsing-remitting multiple sclerosis: a randomised, placebo-controlled, phase 2 trial Stimuli-responsive behavior of composites integrating thermo-responsive gels with photo-responsive fibers Neutrophil-derived microvesicles enter cartilage and protect the joint in inflammatory arthritis A versatile microarray platform for capturing rare cells Long-term culture and expansion of primary human hepatocytes CDKN1A regulates Langerhans cell survival and promotes Treg cell generation upon exposure to ionizing irradiation Dietary obesity reversibly induces synaptic stripping by microglia and impairs hippocampal plasticity The molecular karyotype of 25 clinical-grade human embryonic stem cell lines Human umbilical tissue-derived cells promote synapse formation and neurite outgrowth via thrombospondin family proteins Acquisition of portal venous circulating tumor cells from patients with pancreaticobiliary cancers by endoscopic ultrasound Intravenous multipotent adult progenitor cell treatment decreases inflammation leading to functional recovery following spinal cord injury Trastuzumab emtansine (T-DM1) renders HER2+ breast cancer highly susceptible to CTLA-4/PD-1 blockade Chemical modifications mark alternatively spliced and uncapped messenger RNAs in arabidopsis New approaches to biological pacemakers: links to sinoatrial node development Spontaneous activity of cochlear hair cells triggered by fluid secretion mechanism in adjacent support cells Small cell lung cancer: recruitment of macrophages by circulating tumor cells Type 1 diabetes immunotherapy using polyclonal regulatory T cells Nucleosome stability distinguishes two different promoter types at all protein-coding genes in yeast New details of the human corneal limbus revealed with second harmonic generation imaging Cancer mediates effector T cell dysfunction by targeting microRNAs and EZH2 via glycolysis restriction The interferon-induced transmembrane proteins, IFITM1, IFITM2, and IFITM3 inhibit hepatitis C virus entry Perforin-positive dendritic cells exhibit an immuno-regulatory role in metabolic syndrome and autoimmunity Distinct routes of lineage development reshape the human blood hierarchy across ontogeny Advanced cell therapies: targeting, tracking and actuation of cells with magnetic particles Lithium chloride modulates chondrocyte primary cilia and inhibits Hedgehog signaling Invasive cell fate requires G1 cell-cycle arrest and histone deacetylase-mediated changes in gene expression The ecology of the microbiome: Networks, competition, and stability Noninvasive tracking of gene transcript and neuroprotection after gene therapy Cell-selective arrhythmia ablation for photomodulation of heart rhythm Lanosterol reverses protein aggregation in cataracts Pharmacological chaperone for α-crystallin partially restores transparency in cataract models A comparison of genetically matched cell lines reveals the equivalence of human iPSCs and ESCs Differential responses to lithium in hyperexcitable neurons from patients with bipolar disorder Pericytes are progenitors for coronary artery smooth muscle Atypical PKC-iota controls stem cell expansion via regulation of the Notch pathway Comparison of human embryonic stem cell-derived cardiomyocytes, cardiovascular progenitors, and bone marrow mononuclear cells for cardiac repair SoxC transcription factors are essential for the development of the inner ear Hypothalamic leptin gene therapy reduces body weight without accelerating age-related bone loss A pleiotropic RNA-binding protein controls distinct cell cycle checkpoints to drive resistance of p53-defective tumors to chemotherapy Safe and bodywide muscle transduction in young adult Duchenne muscular dystrophy dogs with adeno-associated virus RNA-seq of tumor-educated platelets enables blood-based pan-cancer, multiclass, and molecular pathway cancer diagnostics A lab-in-a-briefcase for rapid prostate specific antigen (PSA) screening from whole blood Modelling kidney disease with CRISPR-mutant kidney organoids derived from human pluripotent epiblast spheroids Regeneration of thyroid function by transplantation of differentiated pluripotent stem cells Carcinogenic parasite secretes growth factor that accelerates wound healing and potentially promotes neoplasia The transcription factor NR4A1 (Nur77) controls bone marrow differentiation and the survival of Ly6C− monocytes Patrolling monocytes control tumor metastasis to the lung Multiple spatially related pharmacophores define small molecule inhibitors of OLIG2 in glioblastoma Mesenchymal stem cell transplantation reverses multiorgan dysfunction in systemic Lupus Erythematosus mice and humans MSC transplantation improves osteopenia via epigenetic regulation of notch signaling in Lupus Designing synthetic microcapsules that undergo biomimetic communication and autonomous motion Arsenic promotes NF-κB-mediated fibroblast dysfunction and matrix remodeling to impair muscle stem cell function Mesenchymal stem cells use extracellular vesicles to outsource mitophagy and shuttle microRNAs Genetic sharing and heritability of paediatric age of onset autoimmune diseases Kidins220/ARMS binds to the B cell antigen receptor and regulates B cell development and activation Particle dynamics and deposition in true-scale pulmonary acinar models The androgen receptor cistrome is extensively reprogrammed in human prostate tumorigenesis Successful arrest of photoreceptor and vision loss expands the therapeutic window of retinal gene therapy to later stages of disease Clusterin seals the ocular surface barrier in mouse dry eye The protein complex of neurodegeneration-related phosphoinositide phosphatase Sac3 and ArPIKfyve binds the Lewy-body-associated Synphilin-1 preventing its aggregation Anesthesia-induced neuronal apoptosis in the developing retina: a window of opportunity Oct1 and OCA-B are selectively required for CD4 memory T cell function Practical experience of the application of a weighted burden test to whole exome sequence data for obesity and schizophrenia Lysosomal and phagocytic activity is increased in astrocytes during disease progression in the SOD1 G93A mouse model of amyotrophic lateral sclerosis Agonist antibody that induces human malignant cells to kill one another Quantitative time-resolved analysis reveals intricate, differential regulation of standard- and immuno-proteasomes Replication stress is a potent driver of functional decline in ageing haematopoietic stem cells Replication stress caused by low MCM expression limits fetal erythropoiesis and hematopoietic stem cell functionality Nephron organoids derived from human pluripotent stem cells model kidney development and injury Three-dimensional printing of complex biological structures by freeform reversible embedding of suspended hydrogels Is higher serum cholesterol associated with altered tendon structure or tendon pain? A systematic review Identification and characterization of essential genes in the human genome Structure of Tetrahymena telomerase reveals previously unknown subunits, functions, and interactions A basal stem cell signature identifies aggressive prostate cancer phenotypes Neural stem cells rescue cognitive and motor dysfunction in a transgenic model of dementia with Lewy Bodies through a BDNF-dependent mechanism An epigenetic pathway regulates sensitivity of breast cancer cells to HER2 inhibition via FOXO/c-Myc axis Sleep disruption impairs haematopoietic stem cell transplantation in mice A skin-inspired organic digital mechanoreceptor Direct tumor recognition by a human CD4+ T-cell subset potently mediates tumor growth inhibition and orchestrates anti-tumor immune responses Myeloid dysregulation in a human induced pluripotent stem cell model of PTPN11-associated juvenile myelomonocytic leukemia Blood-derived CD4 T cells naturally resist pyroptosis during abortive HIV-1 infection Lack of neuronal IFN-β-IFNAR causes Lewy body- and Parkinson’s Disease-like dementia Partial loss of Rpl11 in adult mice recapitulates Diamond-Blackfan anemia and promotes lymphomagenesis Huntingtin differentially regulates the axonal transport of a sub-set of Rab-containing vesicles in vivo Galectin-1 prevents infection and damage induced by Trypanosoma cruzi on cardiac cells Long-term outcome of patients with AL amyloidosis treated with high-dose melphalan and stem-cell transplantation Directly reprogrammed human neurons retain aging-associated transcriptomic signatures and reveal age-related nucleocytoplasmic defects PAT4 levels control amino-acid sensitivity of rapamycin-resistant mTORC1 from the Golgi and affect clinical outcome in colorectal cancer Childhood to early-midlife systolic blood pressure trajectories: early-life predictors, effect modifiers, and adult cardiovascular outcomes Consequences of zygote injection and germline transfer of mutant human mitochondrial DNA in mice Differentiation of human embryonic stem cells into cone photoreceptors through simultaneous inhibition of BMP, TGFβ and Wnt signaling A modular, DNA-based beacon for single-step fluorescence detection of antibodies and other proteins Disruption of histone methylation in developing sperm impairs offspring health transgenerationally An aminopeptidase in the Drosophila testicular niche acts in germline stem cell maintenance and spermatogonial dedifferentiation Antioxidants can increase melanoma metastasis in mice In vitro screen of a small molecule inhibitor drug library identifies multiple compounds that synergize with oncolytic myxoma virus against human brain tumor-initiating cells Reconstruction and simulation of neocortical microcircuitry Poroelastic foams for simple fabrication of complex soft robots Plasticity-driven individualization of olfactory coding in mushroom body output neurons A metabolome-wide association study of kidney function and disease in the general population Functional classification of memory CD8+ T cells by CX3CR1 expression Relationship between morphological and cytogenetic heterogeneity in invasive micropapillary carcinoma of the breast: a report of one case Ratios of T-cell immune effectors and checkpoint molecules as prognostic biomarkers in diffuse large B-cell lymphoma: a population-based study Human α7 integrin gene (ITGA7) delivered by adeno-associated virus extends survival of severely affected dystrophin/utrophin-deficient mice Human endogenous retrovirus-K contributes to motor neuron disease Structural basis for gene regulation by a B12-dependent photoreceptor LRP2 acts as SHH clearance receptor to protect the retinal margin from mitogenic stimuli SERINC3 and SERINC5 restrict HIV-1 infectivity and are counteracted by Nef HIV-1 Nef promotes infection by excluding SERINC5 from virion incorporation A novel locus of resistance to severe malaria in a region of ancient balancing selection Multiple repressive mechanisms in the hippocampus during memory formation Mondo-Mlx mediates organismal sugar sensing through the gli-similar transcription factor Sugarbabe Arrhythmogenic effects of mutated L-type Ca2+-channels on an optogenetically paced muscular pump in Caenorhabditis elegans SiR–Hoechst is a far-red DNA stain for live-cell nanoscopy Single cell RNA-sequencing of pluripotent states unlocks modular transcriptional variation Hypoxia and loss of PHD2 inactivate stromal fibroblasts to decrease tumour stiffness and metastasis Intestinal stem cell growth and differentiation on a tubular scaffold with evaluation in small and large animals Spatial mapping of juxtacrine axo-glial interactions identifies novel molecules in peripheral myelination Excision of unstable artificial gene-specific inverted repeats mediates scar-free gene deletions in Escherichia coli MCM8-9 complex promotes resection of double-strand break ends by MRE11-RAD50-NBS1 complex Single-cell analysis reveals a stem-cell program in human metastatic breast cancer cells Human satellite cell transplantation and regeneration from diverse skeletal muscles Remote control of therapeutic T cells through a small molecule–gated chimeric receptor Arterial blood, rather than venous blood, is a better source for circulating melanoma cells Neurogenin 3 expressing cells in the human exocrine pancreas have the capacity for endocrine cell fate Human pluripotent stem cell-derived neural constructs for predicting neural toxicity Insulin demand regulates β cell number via the unfolded protein response Hyaluronic acid-serum hydrogels rapidly restore metabolism of encapsulated stem cells and promote engraftment Harnessing the multifunctionality in nature: a bioactive agent release system with self-antimicrobial and immunomodulatory properties Systematic identification of factors for provirus silencing in embryonic stem cells Three different pathways prevent chromosome segregation in the presence of DNA damage or replication stress in budding yeast High mitochondrial respiration and glycolytic capacity represent a metabolic phenotype of human tolerogenic dendritic cells Neuronal differentiation of human mesenchymal stem cells using exosomes derived from differentiating neuronal cells Sonogenetics is a non-invasive approach to activating neurons in Caenorhabditis elegans MYC disrupts the circadian clock and metabolism in cancer cells Co-culturing Escherichia coli O157:H7 with a non-pathogenic E. coli strain increases toxin production and virulence in a germ-free mouse model The splicing regulators Esrp1 and Esrp2 direct an epithelial splicing program essential for mammalian development Control of stochastic and induced switching in biophysical networks Association between vitamin D status and age-related macular degeneration by genetic risk Joint associations of diet, lifestyle, and genes with age-related macular degeneration Frequent derepression of the mesenchymal transcription factor gene FOXC1 in acute myeloid leukemia Safety, efficacy, and immunogenicity of VGX-3100, a therapeutic synthetic DNA vaccine targeting human papillomavirus 16 and 18 E6 and E7 proteins for cervical intraepithelial neoplasia 2/3: a randomised, double-blind, placebo-controlled phase 2b trial Matrix elasticity of void-forming hydrogels controls transplanted-stem-cell-mediated bone formation GITR subverts Foxp3+ Tregs to boost Th9 immunity through regulation of histone acetylation Integrated transcriptome and proteome analyses reveal organ-specific proteome deterioration in old rats Kinome-wide decoding of network-attacking mutations rewiring cancer signaling Unmasking determinants of specificity in the human kinome Cells adapt to the epigenomic disruption caused by histone deacetylase inhibitors through a coordinated, chromatin-mediated transcriptional response Single-cell in situ RNA profiling by sequential hybridization Small-molecule-driven direct reprogramming of mouse fibroblasts into functional neurons Direct conversion of normal and Alzheimer’s disease human fibroblasts into neuronal cells by small molecules Programmed synthesis of three-dimensional tissues Nerve growth factor gene therapy--activation of neuronal responses in Alzheimer disease Chimeric antigen receptor T cells persist and induce sustained remissions in relapsed refractory chronic lymphocytic leukemia Sidekick 2 directs formation of a retinal circuit that detects differential motion Restoration of vision with ectopic expression of human rod opsin Peripheral lesions identified on ultrawide field imaging predict increased risk of diabetic retinopathy progression over 4 years Rapid 3D extrusion of synthetic tumor microenvironments Extended-resolution structured illumination imaging of endocytic and cytoskeletal dynamics Degradation of HK2 by chaperone-mediated autophagy promotes metabolic catastrophe and cell death Characterizing the DNA damage response by cell tracking algorithms and cell features classification using high-content time-lapse analysis CD47 blockade triggers T cell–mediated destruction of immunogenic tumors Dally proteoglycan mediates the autonomous and nonautonomous effects on tissue growth caused by activation of the PI3K and TOR pathways Fetal microchimerism and maternal health: A review and evolutionary analysis of cooperation and conflict beyond the womb Polyol-silk bioink formulations as two-part room-temperature curable materials for 3D printing SpDamID: Marking DNA bound by protein complexes identifies Notch-dimer responsive enhancers Kruppel-like factor 4 is critical for transcriptional control of cardiac mitochondrial homeostasis Disease-associated single-nucleotide polymorphisms from noncoding regions in juvenile idiopathic arthritis are located within or adjacent to functional genomic elements of human neutrophils and CD4+ T cells Adipose tissue-derived mesenchymal stromal cells protect mice infected with Trypanosoma cruzi from cardiac damage through modulation of anti-parasite immunity IL10-driven STAT3 signalling in senescent macrophages promotes pathological eye angiogenesis Hybrid periportal hepatocytes regenerate the injured liver without giving rise to cancer Prostate sphere-forming stem cells are derived from the P63-expressing basal compartment Type 2 fibroblast growth factor receptor signaling preserves stemness and prevents differentiation of prostate stem cells from the basal compartment DNA-demethylating agents target colorectal cancer cells by inducing viral mimicry by endogenous transcripts Distinct EMT programs control normal mammary stem cells and tumour-initiating cells Polarized E-cadherin endocytosis directs actomyosin remodeling during embryonic wound repair PE and PS lipids synergistically enhance membrane poration by a peptide with anticancer properties Gene therapy fully restores vision to the all-cone Nrl−/−Gucy2e−/− mouse model of Leber Congenital Amaurosis-1 Exome sequencing analysis reveals variants in primary immunodeficiency genes in patients with very early onset inflammatory bowel disease Platform technology for scalable assembly of instantaneously functional mosaic tissues Polycomb repressive complex PRC1 spatially constrains the mouse embryonic stem cell genome Materials advances for next-generation ingestible electronic medical devices Glycerophospholipid regulation of modality-specific sensory axon guidance in the spinal cord Oscope identifies oscillatory genes in unsynchronized single-cell RNA-seq experiments Elevated mitochondrial bioenergetics and axonal arborization size are key contributors to the vulnerability of dopamine neurons Distinct E-cadherin-based complexes regulate cell behaviour through miRNA processing or Src and p120 catenin activity Role of tumor pericytes in the recruitment of myeloid-derived suppressor cells DNA-demethylating agents target colorectal cancer cells by inducing viral mimicry by endogenous transcripts Inhibiting DNA methylation causes an interferon response in cancer via dsRNA including endogenous retroviruses Dipeptide species regulate p38MAPK–Smad3 signalling to maintain chronic myelogenous leukaemia stem cells Cell-to-cell transmission of HIV-1 is required to trigger pyroptotic death of lymphoid-tissue-derived CD4 T cells Cell death by pyroptosis drives CD4 T-cell depletion in HIV-1 infection Robust anti-viral immunity requires multiple distinct T cell-dendritic cell interactions Association between vitamin D status and age-related macular degeneration by genetic risk Clinical actionability of multigene panel testing for hereditary breast and ovarian cancer risk assessment Sigma 1 receptor regulates the oxidative stress response in primary retinal Müller glial cells via NRF2 signaling and system xc−, the Na+-independent glutamate–cystine exchanger Preparation and characterisation of antibacterial silver-containing nanofibres for wound healing in diabetic mice A gene-based association method for mapping traits using reference transcriptome data Unjamming and cell shape in the asthmatic airway epithelium Designing synthetic microcapsules that undergo biomimetic communication and autonomous motion Characterization of a steroid receptor coactivator small molecule stimulator that overstimulates cancer cells and leads to cell stress and death Real-time imaging reveals local, transient vascular permeability, and tumor cell intravasation stimulated by TIE2hi macrophage–derived VEGFA Complete biosynthesis of opioids in yeast Pancreatic cancer metastases harbor evidence of polyclonality AAV9 delivering a modified human Mullerian inhibiting substance as a gene therapy in patient-derived xenografts of ovarian cancer Humanized mice reveal differential immunogenicity of cells derived from autologous induced pluripotent stem cells Microbiota-dependent activation of an autoreactive T cell receptor provokes autoimmunity in an immunologically privileged site Early pathogenesis of Duchenne muscular dystrophy modelled in patient-derived human induced pluripotent stem cells Enhanced efficiency of genetic programming toward cardiomyocyte creation through topographical cues Retinal angiogenesis effects of TGF-ß1, and paracrine factors secreted from human placental stem cells in response to a pathological environment Exercise training causes differential changes in gene expression in diaphragm arteries and 2A arterioles of obese rats LINE-1 expression and retrotransposition in Barrett’s esophagus and esophageal carcinoma Retrotransposon insertions in the clonal evolution of pancreatic ductal adenocarcinoma Widespread somatic L1 retrotransposition occurs early during gastrointestinal cancer evolution Matrix-metalloproteinase-9 is cleaved and activated by Cathepsin K A nanobody-based system using fluorescent proteins as scaffolds for cell-specific gene manipulation Cell type–specific manipulation with GFP-dependent Cre recombinase Coacervate delivery of growth factors combined with a degradable hydrogel preserves heart function after myocardial infarction Differential connexin function enhances self-renewal in glioblastoma Embryonic stem cells license a high level of dormant origins to protect the genome against replication stress Fate of distal lung epithelium cultured in a decellularized lung extracellular matrix Commissural axonal corridors instruct neuronal migration in the mouse spinal cord A hyaluronan-based injectable hydrogel improves the survival and integration of stem cell progeny following transplantation Clonal deletion prunes but does not eliminate self-specific αβ CD8+ T lymphocytes Advances in reprogramming-based study of neurologic disorders Plasticity of the human visual system after retinal gene therapy in patients with Leber’s congenital amaurosis Metabolic rescue in pluripotent cells from patients with mtDNA disease A multimaterial bioink method for 3D printing tunable, cell-compatible hydrogels Three-dimensional printing of high-content graphene scaffolds for electronic and biomedical applications FOXG1-dependent dysregulation of GABA/glutamate neuron differentiation in autism spectrum disorders The carbonic anhydrase inhibitor ethoxzolamide inhibits the mycobacterium tuberculosis PhoPR Regulon and Esx-1 secretion and attenuates virulence Changes in genetic risk for emotional eating across the menstrual cycle: a longitudinal study Single-cell migration chip for chemotaxis-based microfluidic selection of heterogeneous cell populations NY-ESO-1–specific TCR–engineered T cells mediate sustained antigen-specific antitumor effects in myeloma Inhibition of the alternative complement pathway preserves photoreceptors after retinal injury A microfluidic device for label-free, physical capture of circulating tumor cell clusters The mouse brain metabolome: region-specific signatures and response to excitotoxic neuronal injury PDGFB-based stem cell gene therapy increases bone strength in the mouse Near-infrared emitting and pro-angiogenic electrospun conjugated polymer scaffold for optical biomaterial tracking Cell therapy using human induced pluripotent stem cell-derived renal progenitors ameliorates acute kidney injury in mice Adoptive transfer of activated marrow-infiltrating lymphocytes induces measurable antitumor immunity in the bone marrow in multiple myeloma Reinforcement of hydrogels using three-dimensionally printed microfibers Size- and shape-dependent foreign body immune response to materials implanted in rodents and non-human primates Telomerase abrogates aneuploidy‐induced telomere replication stress, senescence and cell depletion In vivo single-cell labeling by confined primed conversion The microRNA-200 family regulates pancreatic beta cell survival in type 2 diabetes Vibrational imaging of glucose uptake activity in live cells and tissues by stimulated Raman scattering Low-dose irradiation enhances gene targeting in human pluripotent stem cells TLR-2 signaling promotes IL-17A production in CD4+CD25+Foxp3+ regulatory cells during oropharyngeal candidiasis Kinetics of CO2 exchange with carbonic anhydrase immobilized on fiber membranes in artificial lungs Acidic sweep gas with carbonic anhydrase coated hollow fiber membranes synergistically accelerates CO2 removal from blood Endothelial NO-synthase gene-enhanced progenitor cell therapy for Pulmonary Arterial Hypertension: the PHACeT trial Inducing stem cell myogenesis using NanoScript Co-option of membrane wounding enables virus penetration into cells Preconditioning allows engraftment of mouse and human embryonic lung cells, enabling lung repair in mice The genetic landscape of hematopoietic stem cell frequency in mice CNTF gene therapy confers lifelong neuroprotection in a mouse model of human retinitis pigmentosa Metabolic rescue in pluripotent cells from patients with mtDNA disease Retinoic acid differentially regulates the migration of innate lymphoid cell subsets to the gut Disruption of cytochrome c oxidase function induces the Warburg effect and metabolic reprogramming Loss of α(E)-catenin promotes Fas mediated apoptosis in tubular epithelial cells Positively charged oligo[poly(ethylene glycol) fumarate] scaffold implantation results in a permissive lesion environment after spinal cord injury in rat Netrin-1 regulates somatic cell reprogramming and pluripotency maintenance An siRNA-based functional genomics screen for the identification of regulators of ciliogenesis and ciliopathy genes Targeting the microRNA passenger strand for regulating therapeutic transgenes Polymeric nanoparticles for nonviral gene therapy extend brain tumor survival in vivo Recurrent fusion genes in gastric cancer: CLDN18-ARHGAP26 induces loss of epithelial integrity Novel protein Callipygian defines the back of migrating cells Infusion of human bone marrow-derived mesenchymal stem cells alleviates autoimmune nephritis in a lupus model by suppressing follicular helper T cell development Spraying respiratory epithelial cells to coat tissue-engineered constructs Diversity, cellular origin and autoreactivity of antibody-secreting cell population expansions in acute systemic lupus erythematosus Long-lived plasma cells are contained within the CD19−CD38hiCD138+ subset in human bone marrow Intrathecal bone marrow stromal cells inhibit neuropathic pain via TGF-β secretion Kinetochore-localized PP1–Sds22 couples chromosome segregation to polar relaxation Atomic gold–enabled three-dimensional lithography for silicon mesostructures Ets factors regulate neural stem cell depletion and gliogenesis in Ras pathway glioma Therapeutic effects of glatiramer acetate and grafted CD115+ monocytes in a mouse model of Alzheimer’s disease Mobile element insertions are frequent in oesophageal adenocarcinomas and can mislead paired-end sequencing analysis Self-organizing human cardiac microchambers mediated by geometric confinement Lymphatic vessels arise from specialized angioblasts within a venous niche Distinct transcriptional programs underlie Sox9 regulation of the mammalian chondrocyte Digital microfluidic immunocytochemistry in single cells Quantification of retinogenesis in 3D cultures reveals epigenetic memory and higher efficiency in iPSCs derived from rod photoreceptors Schwann cell autophagy, myelinophagy, initiates myelin clearance from injured nerves Dynamic epigenetic regulation of glioblastoma tumorigenicity through LSD1 modulation of MYC expression Somatic mutations and clonal hematopoiesis in aplastic anemia Microglial phagocytosis of living photoreceptors contributes to inherited retinal degeneration Are migraineurs naturally born “well-hearted”? Nanotubes mediate niche–stem-cell signalling in the Drosophila testis Trophic effects of dental pulp stem cells on Schwann cells in peripheral nerve regeneration Highly parallel genome-wide expression profiling of individual cells using nanoliter droplets Droplet barcoding for single-cell transcriptomics applied to embryonic stem cells Concentration- and chromosome-organization-dependent regulator unbinding from DNA for transcription regulation in living cells Reversal of mitochondrial defects with CSB-dependent serine protease inhibitors in patient cells of the progeroid Cockayne syndrome Autoantibody-targeted treatments for acute exacerbations of idiopathic pulmonary fibrosis A highly elastic and rapidly crosslinkable elastin-like polypeptide-based hydrogel for biomedical applications A highly elastic and rapidly crosslinkable elastin-like polypeptide-based hydrogel for biomedical applications Genetic analysis for a shared biological basis between migraine and coronary artery disease Quantification of retinogenesis in 3D cultures reveals epigenetic memory and higher efficiency in iPSCs derived from rod photoreceptors Broad anti-tumor activity of a small molecule that selectively targets the Warburg Effect and lipogenesis Determination of the action spectrum of UVR-induced mitochondrial DNA damage in human skin cells High IFN-γ and low SLPI mark severe asthma in mice and humans Cell-cell communication in yeast using auxin biosynthesis and auxin responsive CRISPR transcription factors Bivalent separation into univalents precedes age-related meiosis I errors in oocytes Induction of the intestinal stem cell signature gene SMOC-2 is required for L1-mediated colon cancer progression HIV-specific immunity derived from chimeric antigen receptor-engineered stem cells Magnetic levitation of single cells Decay in survival motor neuron and plastin 3 levels during differentiation of iPSC-derived human motor neurons T-cell exhaustion, co-stimulation and clinical outcome in autoimmunity and infection MicroRNA-132 enhances transition from inflammation to proliferation during wound healing A neuronal DNA damage response is detected at the earliest stages of Alzheimer's neuropathology and correlates with cognitive impairment in the Medical Research Council's Cognitive Function and Ageing Study ageing brain cohort Histone demethylases KDM4A and KDM4C regulate differentiation of embryonic stem cells to endothelial cells MARCKS-dependent mucin clearance and lipid metabolism in ependymal cells are required for maintenance of forebrain homeostasis during aging Skipped-stimulus approach reveals that short-term plasticity dominates synaptic strength during ongoing activity Three-year outcomes of bariatric surgery vs lifestyle intervention for type 2 diabetes mellitus treatment: a randomized clinical trial Adipose-derived stem cells from diabetic mice show impaired vascular stabilization in a murine model of diabetic retinopathy Selective susceptibility of human skin antigen presenting cells to productive dengue virus infection Frizzled7 functions as a Wnt receptor in intestinal epithelial Lgr5+ stem cells Cell death during crisis is mediated by mitotic telomere deprotection Structural basis of thymosin-β4/profilin exchange leading to actin filament polymerization Xenogeneic mesenchymal stromal cells improve wound healing and modulate the immune response in an extensive burn model Development and rescue of human familial hypercholesterolaemia in a xenograft mouse model Quiescence of memory CD8 T cells is mediated by regulatory T cells through inhibitory receptor CTLA-4 Interferon-induced mechanosensing defects impede apoptotic cell clearance in lupus Autologous olfactory lamina propria transplantation for chronic spinal cord injury: three-year follow-up outcomes from a prospective double blinded clinical trial Streptococcus pneumoniae secretes hydrogen peroxide leading to DNA damage and apoptosis in lung cells PhyloGene server for identification and visualization of co-evolving proteins using normalized phylogenetic profiles Krt19+/Lgr5−cells are radioresistant cancer-initiating stem cells in the colon and intestine Preclinical and clinical evidence of mycobacterium tuberculosis persistence in the hypoxic niche of bone marrow mesenchymal stem cells after therapy In vivo quantification of cochlin in glaucomatous DBA/2J mice using optical coherence tomography DNMT1 is essential for mammary and cancer stem cell maintenance and tumorigenesis SIV encephalitis lesions are composed of CD163+ macrophages present in the central nervous system during early SIV infection and SIV-positive macrophages recruited terminally with AIDS Inducible caspase-9 suicide gene controls adverse effects from alloreplete T cells after haploidentical stem cell transplantation Systemic attenuation of the TGF-β pathway by a single drug simultaneously rejuvenates hippocampal neurogenesis and myogenesis in the same old mammal ATM couples replication stress and metabolic reprogramming during cellular senescence Exome sequencing links mutations in PARN and RTEL1 with familial pulmonary fibrosis and telomere shortening Siglec receptors impact mammalian lifespan by modulating oxidative stress Massively parallel delivery of large cargo into mammalian cells with light pulses Analysis of loss-of-function variants and 20 risk factor phenotypes in 8,554 individuals identifies loci influencing chronic disease The basal transcription complex component TAF3 transduces changes in nuclear phosphoinositides into transcriptional output Direct in vivo assessment of human stem cell graft–host neural circuits Therapeutic effects of cell-permeant peptides that activate G proteins downstream of growth factors Histone H3.3 is required for endogenous retroviral element silencing in embryonic stem cells Improvement and decline in vision with gene therapy in childhood blindness Global developmental gene programing involves a nuclear form of fibroblast growth factor receptor-1 (FGFR1) Oxygen and glucose deprivation induces widespread alterations in mRNA translation within 20 minutes Federal regulatory oversight of US clinics marketing adipose-derived autologous stem cell interventions: insights from 3 new FDA draft guidance documents Human embryonic stem cell-derived retinal pigment epithelium in patients with age-related macular degeneration and Stargardt's macular dystrophy: follow-up of two open-label phase 1/2 studies Treatment of macular degeneration using embryonic stem cell-derived retinal pigment epithelium: preliminary results in asian patients Functional integration of human neural precursor cells in mouse cortex Perinatal outcomes and unconventional natural gas operations in southwest Pennsylvania Functional integration of human neural precursor cells in mouse cortex Calcium release channel RyR2 regulates insulin release and glucose homeostasis The innate immune system contributes to tissue-engineered vascular graft performance A model of breast cancer heterogeneity reveals vascular mimicry as a driver of metastasis G&T-seq: parallel sequencing of single-cell genomes and transcriptomes Group 3 innate lymphoid cells mediate intestinal selection of commensal bacteria–specific CD4+ T cells New self-assembling multifunctional templates for the biofabrication and controlled self-release of cultured tissue Twenty-four-hour intraocular pressure patterns in patients with thyroid eye disease Chemically fixed autologous feeder cell-derived niche for human induced pluripotent stem cell culture Paternally contributed centrioles exhibit exceptional persistence in C. elegans embryos Neurovascular crosstalk between interneurons and capillaries is required for vision FOXO1 differentially regulates both normal and diabetic wound healing Direct neuronal glucose uptake heralds activity-dependent increases in cerebral metabolism ATP synthase promotes germ cell differentiation independent of oxidative phosphorylation siRNA-based spherical nucleic acids reverse impaired wound healing in diabetic mice by ganglioside GM3 synthase knockdown Galanin modulates the neural niche to favour perineural invasion in head and neck cancer Targeting breast to brain metastatic tumours with death receptor ligand expressing therapeutic stem cells Correction of human phospholamban R14del mutation associated with cardiomyopathy using targeted nucleases and combination therapy Ultrasound-induced modulation of cardiac rhythm in neonatal rat ventricular cardiomyocytes Placental mesenchymal stromal cells rescue ambulation in ovine myelomeningocele The Xist lncRNA interacts directly with SHARP to silence transcription through HDAC3 Functionally active virus-specific T cells that target CMV, adenovirus, and EBV can be expanded from naive T-cell populations in cord blood and will target a range of viral epitopes CMV-specific T cells generated from naïve T cells recognize atypical epitopes and may be protective in vivo Intratumoral myeloid cells regulate responsiveness and resistance to antiangiogenic therapy Evaluation of postural control in patients with glaucoma using a virtual reality environment The basic helix-loop-helix transcription factor E47 reprograms human pancreatic cancer cells to a quiescent acinar state with reduced tumorigenic potential An emerging era of clinical benefit from gene therapy Outcomes following gene therapy in patients with severe Wiskott-Aldrich Syndrome Drug-based modulation of endogenous stem cells promotes functional remyelination in vivo Heightened potency of human pluripotent stem cell lines created by transient BMP4 exposure Repression of SRF target genes is critical for Myc‐dependent apoptosis of epithelial cells Molecular remodeling of the presynaptic active zone of Drosophila photoreceptors via activity-dependent feedback A single epidermal stem cell strategy for safe ex vivo gene therapy Anoikis evasion in inflammatory breast cancer cells is mediated by Bim-EL sequestration The role of multicellular aggregation in the survival of ErbB2-positive breast cancer cells during extracellular matrix detachment Regulatory T cells are not a strong predictor of survival for patients with glioblastoma Autologous adipose tissue-derived stromal vascular fraction cells application in patients with osteoarthritis Innate lymphoid cells control early colonization resistance against intestinal pathogens through ID2-dependent regulation of the microbiota A prevascularized subcutaneous device-less site for islet and cellular transplantation The suture provides a niche for mesenchymal stem cells of craniofacial bones Foxp1-mediated programming of limb-innervating motor neurons from mouse and human embryonic stem cells Three-dimensional imaging of biological cells with picosecond ultrasonics Reciprocal cellular cross-talk within the tumor microenvironment promotes oncolytic virus activity Real-time visualization of nanoparticles interacting with glioblastoma stem cells Towards protein-based viral mimetics for cancer therapies Serum- glucocorticoid-inducible kinase 1 confers protection in cell-based and in in vivo neurotoxin models via the c-Jun N-terminal kinase signaling pathway In situ vascularization of injectable fibrin/poly(ethylene glycol) hydrogels by human amniotic fluid-derived stem cells CDK1 substitutes for mTOR kinase to activate mitotic cap-dependent protein translation Plasticity of Hopx+ type I alveolar cells to regenerate type II cells in the lung Trauma in silico: individual-specific mathematical models and virtual clinical populations Faster T-cell development following gene therapy compared to haplo-identical hematopoietic stem cell transplantation in the treatment of SCID-X1 Modeling familial cancer with induced pluripotent stem cells Functional analysis of the engineered cardiac tissue grown on recombinant spidroin fiber meshes YAP1 regulates OCT4 activity and SOX2 expression to facilitate self-renewal and vascular mimicry of stem-like cells High-resolution whole-brain staining for electron microscopic circuit reconstruction A comprehensive library of familial human amyotrophic lateral sclerosis induced pluripotent stem cells KPC1-mediated ubiquitination and proteasomal processing of NF-κB1 p105 to p50 restricts tumor growth Bending gradients: how the intestinal stem cell gets its home Microencapsulated equine mesenchymal stromal cells promote cutaneous wound healing in vitro Human iPSC-derived neural progenitors preserve vision in an AMD-like model Enhancement of radiation effect on cancer cells by gold-pHLIP Efficiency of conditionally attenuated Salmonella enterica serovar typhimurium in bacterium-mediated tumor therapy Interplay between chemotaxis and contact inhibition of locomotion determines exploratory cell migration Erk2 phosphorylation of Drp1 promotes mitochondrial fission and MAPK-driven tumor growth Asymmetric apportioning of aged mitochondria between daughter cells is required for stemness Robust enumeration of cell subsets from tissue expression profiles Genetic and functional characterization of clonally derived adult human brown adipocytes The transcriptional regulators IRF4, BATF and IL-33 orchestrate development and maintenance of adipose tissue–resident regulatory T cells Predicting internal cell fluxes at sub-optimal growth Microsecond scale vibrational spectroscopic imaging by multiplex stimulated Raman scattering microscopy A novel link between Fic (filamentation induced by cAMP)-mediated adenylylation/AMPylation and the unfolded protein response Patterned and functionalized nanofiber scaffolds in three-dimensional hydrogel constructs enhance neurite outgrowth and directional control Novel advancements in three-dimensional neural tissue engineering and regenerative medicine Telomerase mutations in smokers with severe emphysema Telomere dysfunction causes alveolar stem cell failure Label-free in vivo molecular imaging of underglycosylated mucin-1 expression in tumour cells Antiaging treatment of the facial skin by fat graft and adipose-derived stem cells Inflammatory dysregulation of blood monocytes in Parkinson's disease patients Infiltration of circulating myeloid cells through CD95L contributes to neurodegeneration in mice Acoustic separation of circulating tumor cells Mitochondrial alterations by PARKIN in dopaminergic neurons using PARK2 patient-specific and PARK2 knockout isogenic ipsc lines Mitomycin-treated undifferentiated embryonic stem cells as a safe and effective therapeutic strategy in a mouse model of Parkinson’s disease Designing dual-functionalized gels for self-reconfiguration and autonomous motion In vivo and systems biology studies implicate IL-18 as a central mediator in chronic pain Long-term mechanical circulatory support (destination therapy): on track to compete with heart transplantation? A computational, tissue-realistic model of pressure ulcer formation in individuals with spinal cord injury Achieving synchronization with active hybrid materials: Coupling self-oscillating gels and piezoelectric films Embryonic origin of postnatal neural stem cells Embryonic stem cell–derived exosomes promote endogenous repair mechanisms and enhance cardiac function following myocardial infarction A new model for post-integration latency in macroglial cells to study HIV-1 reservoirs of the brain The nucleoporin Nup153 regulates embryonic stem cell pluripotency through gene silencing Apc restoration promotes cellular differentiation and reestablishes crypt homeostasis in colorectal cancer Functionally distinct subsets of lineage-biased multipotent progenitors control blood production in normal and regenerative conditions Dipeptidylpeptidase 4 inhibition enhances lymphocyte trafficking, improving both naturally occurring tumor immunity and immunotherapy Artificial membrane-binding proteins stimulate oxygenation of stem cells during engineering of large cartilage tissue Diabetes primes neutrophils to undergo NETosis, which impairs wound healing Single mammalian cells compensate for differences in cellular volume and DNA copy number through independent global transcriptional mechanisms shRNA targeting α-synuclein prevents neurodegeneration in a Parkinson’s disease model A new technique for modeling neuronal connectivity using human pluripotent stem cells MtDNA mutagenesis disrupts pluripotent stem cell function by altering redox signaling A combined omics approach to generate the surface atlas of human naive CD4 T cells during early TCR activation Decrease in cell volume generates contractile forces driving dorsal closure Potent cell-intrinsic immune responses in dendritic cells facilitate HIV-1-specific T cell immunity in HIV-1 elite controllers Optical imaging of the chorioretinal vasculature in the living human eye Transcription factor PRDM8 is required for rod bipolar and type 2 OFF-cone bipolar cell survival and amacrine subtype identity Generation of induced pluripotent stem cells from frozen buffy coats using non-integrating episomal plasmids Corrigendum: a common variant mapping to CACNA1A is associated with susceptibility to exfoliation syndrome Real-time imaging of dendritic cell responses to sterile tissue injury hESC differentiation toward an autonomic neuronal cell fate depends on distinct cues from the co-patterning vasculature High graft CD8 cell dose predicts improved survival and enables better donor selection in allogeneic stem-cell transplantation with reduced-intensity conditioning Dynamical system modeling of immune reconstitution after allogeneic stem cell transplantation identifies patients at risk for adverse outcomes Human embryonic stem cell-derived progenitors assist functional sensory regeneration after dorsal root avulsion injury A unique gene regulatory network resets the human germline epigenome for development Cell fusion connects oncogenesis with tumor evolution Myxoma virus suppresses proliferation of activated T lymphocytes yet permits oncolytic virus transfer to cancer cells Modulation of cell function by electric field: a high-resolution analysis Autologous bone marrow mononuclear cells reduce therapeutic intensity for severe traumatic brain injury in children Aging-induced stem cell mutations as drivers for disease and cancer A noisy linear map underlies oscillations in cell size and gene expression in bacteria Can metabolic mechanisms of stem cell maintenance explain aging and the immortal germline? Programming and reprogramming cellular age in the era of induced pluripotency Stem cell aging and sex: are we missing something? Single transcription factor conversion of human blood fate to NPCs with CNS and PNS developmental capacity Genetic absence of PD-1 promotes accumulation of terminally differentiated exhausted CD8+ T cells Functional cortical neurons and astrocytes from human pluripotent stem cells in 3D culture Potential of systemic allogeneic mesenchymal stromal cell therapy for children with recessive dystrophic epidermolysis bullosa Prmt5 is a regulator of muscle stem cell expansion in adult mice 3D printing of highly stretchable and tough hydrogels into complex, cellularized structures Microglia regulate blood clearance in subarachnoid hemorrhage by heme oxygenase-1 Functionalised nanoscale coatings using layer-by-layer assembly for imparting antibacterial properties to polylactide-co-glycolide surfaces Folding and imaging of DNA nanostructures in anhydrous and hydrated deep-eutectic solvents Allogeneic neural stem/progenitor cells derived from embryonic stem cells promote functional recovery after transplantation into injured spinal cord of nonhuman primates Two knockdown models of the autism genes SYNGAP1 and SHANK3 in zebrafish produce similar behavioral phenotypes associated with embryonic disruptions of brain morphogenesis Chromothripsis from DNA damage in micronuclei T follicular helper cells have distinct modes of migration and molecular signatures in naive and memory immune responses Sensitive detection of chromatin-altering polymorphisms reveals autoimmune disease mechanisms KPC and NDM-1 genes in related Enterobacteriaceae strains and plasmids from Pakistan and the United States Posttraumatic stress disorder and incident heart failure among a community-based sample of US veterans Circulating tumor cell biomarker panel as an individual-level surrogate for survival in metastatic castration-resistant prostate cancer Endogenous metabolites and inflammasome activity in early childhood and links to respiratory diseases Functional analysis of a chromosomal deletion associated with myelodysplastic syndromes using isogenic human induced pluripotent stem cells IP3 3-kinase B controls hematopoietic stem cell homeostasis and prevents lethal hematopoietic failure in mice Characterization of host and microbial determinants in individuals with latent Tuberculosis infection using a human granuloma model Incomplete immune reconstitution despite virologic suppression in HIV-1 infected children and adolescents Myocardial healing requires Reg3β-dependent accumulation of macrophages in the ischemic heart In vitro generation of human pluripotent stem cell derived lung organoids Design and synthesis of a MAO-B-selectively activated prodrug based on MPTP: a mitochondria-targeting chemotherapeutic agent for treatment of human malignant gliomas NRF2 promotes neuronal survival in neurodegeneration and acute nerve damage Fidgetin-like 2: a microtubule-based regulator of wound healing Functional heterogeneity in the CD4+ T cell response to murine γ-herpesvirus 68 A novel risk score to predict cardiovascular disease risk in national populations (Globorisk): a pooled analysis of prospective cohorts and health examination surveys Neuromedin S-producing neurons act as essential pacemakers in the suprachiasmatic nucleus to couple clock neurons and dictate circadian rhythms The long noncoding RNA Pnky regulates neuronal differentiation of embryonic and postnatal neural stem cells Reprogramming of primary human Philadelphia chromosome-positive B cell acute lymphoblastic leukemia cells into nonleukemic macrophages Pioneer factors govern super-enhancer dynamics in stem cell plasticity and lineage choice MG53-mediated cell membrane repair protects against acute kidney injury Combination therapy of mesenchymal stem cells and serelaxin effectively attenuates renal fibrosis in obstructive nephropathy A soluble biocompatible guanidine-containing polyamidoamine as promoter of primary brain cell adhesion and in vitro cell culturing Transgenic mice with a diverse human T cell antigen receptor repertoire Identification of human T-cell receptors with optimal affinity to cancer antigens using antigen-negative humanized mice Deletion of macrophage vitamin D receptor promotes insulin resistance and monocyte cholesterol transport to accelerate atherosclerosis in mice Maturation of the proteasome core particle induces an affinity switch that controls regulatory particle association Cell growth density modulates cancer cell vascular invasion via Hippo pathway activity and CXCR2 signaling High-throughput fluorescence correlation spectroscopy enables analysis of proteome dynamics in living cells In vivo study of magnesium plate and screw degradation and bone fracture healing Collisions of deformable cells lead to collective migration Targeting bacteria via iminoboronate chemistry of amine-presenting lipids Treating diet-induced diabetes and obesity with human embryonic stem cell-derived pancreatic progenitor cells and antidiabetic drugs Image fusion of mass spectrometry and microscopy: a multimodality paradigm for molecular tissue mapping Liver-directed lentiviral gene therapy in a dog model of hemophilia B ChIP-nexus enables improved detection of in vivo transcription factor binding footprints Mouse low-grade gliomas contain cancer stem cells with unique molecular and functional properties Virus-specific T lymphocytes home to the skin during natural dengue infection DNA damage shifts circadian clock time via Hausp-dependent Cry1 stabilization The Achilles’ heel of senescent cells: from transcriptome to senolytic drugs Elucidating molecular phenotypes caused by the SORL1 Alzheimer’s disease genetic risk factor using human induced pluripotent stem cells Lymphoid regeneration from Gene-corrected SCID-X1 subject-derived iPSCs Surgery versus nonsurgical treatment of lumbar spinal stenosis: a randomized trial Neuregulin stimulation of cardiomyocyte regeneration in mice and human myocardium reveals a therapeutic window A high-throughput chemical screen reveals that harmine-mediated inhibition of DYRK1A increases human pancreatic beta cell replication Snai1 regulates cell lineage allocation and stem cell maintenance in the mouse intestinal epithelium Wireless magnetothermal deep brain stimulation An autologous endothelial cell:peripheral blood mononuclear cell assay that detects cytokine storm responses to biologics Disruption of DNA-methylation-dependent long gene repression in Rett syndrome Fast clonal expansion and limited neural stem cell self-renewal in the adult subependymal zone Human Ebola virus infection results in substantial immune activation Systemic administration of epothilone B promotes axon regeneration after spinal cord injury Human Leukocyte Antigen (HLA) A*1101-restricted Epstein-Barr virus-specific T-cell receptor gene transfer to target Nasopharyngeal carcinoma Notch1–Dll4 signalling and mechanical force regulate leader cell formation during collective cell migration Common polygenic risk for autism spectrum disorder (ASD) is associated with cognitive ability in the general population Media Portray Unrealistic Timelines for Stem Cell Therapies Evolutionary resurrection of flagellar motility via rewiring of the nitrogen regulation system Analysis of the genetic phylogeny of multifocal prostate cancer identifies multiple independent clonal expansions in neoplastic and morphologically normal prostate tissue Interplay between population firing stability and single neuron dynamics in hippocampal networks An aptamer-functionalized chemomechanically modulated biomolecule catch-and-release system Mitochondrial membrane potential is regulated by vimentin intermediate filaments Implantable hydrogel embedded dark-gold nanoswitch as a theranostic probe to sense and overcome cancer multidrug resistance Immunological mechanisms of the antitumor effects of supplemental oxygenation Neurotrophin signaling via TrkB and TrkC receptors promotes the growth of brain tumor-initiating cells Cartilage repair using human embryonic stem cell-derived chondroprogenitors Mouse mammary stem cells express prognostic markers for triple-negative breast cancer Wnt7a is a novel inducer of β-catenin-independent tumor-suppressive cellular senescence in lung cancer Sox2 functions as a sequence-specific DNA sensor in neutrophils to initiate innate immunity against microbial infection Transcription factor and microRNA interactions in lung cells: an inhibitory link between NK2 homeobox 1, miR-200c and the developmental and oncogenic factors Nfib and Myb Retroviral vectors elevate coexpressed protein levels in trans through cap-dependent translation Dynamic transcription of distinct classes of endogenous retroviral elements marks specific populations of early human embryonic cells Controlled-release mitochondrial protonophore reverses diabetes and steatohepatitis in rats Genome-wide association study identifies peanut allergy-specific loci and evidence of epigenetic mediation in US children Hepatic stellate cell‐expressed endosialin balances fibrogenesis and hepatocyte proliferation during liver damage A small-molecule screen for enhanced homing of systemically infused cells In vivo generation of a mature and functional artificial skeletal muscle Two-pore channels control Ebola virus host cell entry and are drug targets for disease treatment Increased risk of genetic and epigenetic instability in human embryonic stem cells associated with specific culture conditions TGF-β promotes heterogeneity and drug resistance in squamous cell carcinoma Genetic studies of body mass index yield new insights for obesity biology Zyxin antagonizes the FERM protein expanded to couple F-actin and yorkie-dependent organ growth Protein kinase D1 drives pancreatic acinar cell reprogramming and progression to intraepithelial neoplasia An evolutionary role for HIV latency in enhancing viral transmission A hardwired HIV latency program DENND2B activates Rab13 at the leading edge of migrating cells and promotes metastatic behavior Individual T helper cells have a quantitative cytokine memory Dietary emulsifiers impact the mouse gut microbiota promoting colitis and metabolic syndrome Generation of neuropeptidergic hypothalamic neurons from human pluripotent stem cells Differentiation of hypothalamic-like neurons from human pluripotent stem cells Th17 inflammation model of oropharyngeal candidiasis in immunodeficient mice Visual impairment and blindness avoided with ranibizumab in hispanic and non-hispanic whites with diabetic macular edema in the United States (-)-Oleocanthal rapidly and selectively induces cancer cell death via lysosomal membrane permeabilization (LMP) Adipogenic differentiation of hMSCs is mediated by recruitment of IGF-1R onto the primary cilium associated with cilia elongation Rational development and characterization of humanized anti–EGFR variant III chimeric antigen receptor T cells for glioblastoma Integrative analysis of 111 reference human epigenomes Aflibercept, bevacizumab, or ranibizumab for diabetic macular edema Self-assembled hydrogels utilizing polymer–nanoparticle interactions Engineering gold nanotubes with controlled length and near-infrared absorption for theranostic applications Cell types in the mouse cortex and hippocampus revealed by single-cell RNA-seq Mechanical stress and network structure drive protein dynamics during cytokinesis Stem cell transplantation reverses chemotherapy-induced cognitive dysfunction A conserved regulatory logic controls temporal identity in mouse neural progenitors Resetting the transcription factor network reverses terminal chronic hepatic failure Fine-mapping identifies two additional breast cancer susceptibility loci at 9q31.2 Exit from dormancy provokes DNA-damage-induced attrition in haematopoietic stem cells CRISPR-based self-cleaving mechanism for controllable gene delivery in human cells Whole-exome sequencing points to considerable genetic heterogeneity of cerebral palsy Force-controlled patch clamp of beating cardiac cells Immature myeloid cells directly contribute to skin tumor development by recruiting IL-17–producing CD4+ T cells 64Cu antibody-targeting of the T-cell receptor and subsequent internalization enables in vivo tracking of lymphocytes by PET Distinct mechanisms regulating mechanical force-induced Ca2+ signals at the plasma membrane and the ER in human MSCs Characteristic patterns of dendritic remodeling in early-stage glaucoma: evidence from genetically identified retinal ganglion cell types Identification of hydroxyapatite spherules provides new insight into subretinal pigment epithelial deposit formation in the aging eye Protein kinase CK2 enables regulatory T cells to suppress excessive TH2 responses in vivo MnSOD upregulation sustains the Warburg effect via mitochondrial ROS and AMPK-dependent signaling in cancer Pharmacological activation of myosin II paralogs to correct cell mechanics defects Binding of the Fap2 protein of Fusobacterium nucleatum to human inhibitory receptor TIGIT protects tumors from immune cell attack Human umbilical cord blood cells induce neuroprotective change in gene expression profile in neurons after ischemia through activation of Akt pathway A light-inducible CRISPR-Cas9 system for control of endogenous gene activation Blood biocompatibility of surface-bound multi-walled carbon nanotubes Temporally sequenced anticancer drugs overcome adaptive resistance by targeting a vulnerable chemotherapy-induced phenotypic transition Monoterpene (−)-citronellal affects hepatocarcinoma cell signaling via an olfactory receptor B-lymphocyte-mediated delayed cognitive impairment following stroke Expenditures and health status among adults with back and neck problems Repression of intestinal stem cell function and tumorigenesis through direct phosphorylation of β-catenin and Yap by PKCζ Rapid reprogramming of epigenetic and transcriptional profiles in mammalian culture systems Memory T cells specific for murine cytomegalovirus re-emerge after multiple challenges and recapitulate immunity in various adoptive transfer scenarios Life-long in vivo cell-lineage tracing shows that no oogenesis originates from putative germline stem cells in adult mice Class-switched memory B cells remodel BCRs within secondary germinal centers HIV-1 integration landscape during latent and active infection Human iPSC-derived hepatocyte-like cells support plasmodium liver-stage infection in vitro NPD1-mediated stereoselective regulation of BIRC3 expression through cREL is decisive for neural cell survival Polymeric nanoparticles for nonviral gene therapy extend brain tumor survival in vivo Tumor-specific cytotoxic T lymphocyte activity determines colorectal cancer patient prognosis Computational analysis of cell-to-cell heterogeneity in single-cell RNA-sequencing data reveals hidden subpopulations of cells Real-time deformability cytometry: on-the-fly cell mechanical phenotyping Disruption of the head direction cell network impairs the parahippocampal grid cell signal Variable expression of PIK3R3 and PTEN in Ewing Sarcoma impacts oncogenic phenotypes Human dermal CD14⁺ cells are a transient population of monocyte-derived macrophages Maturation of embryonic tissues in a lymph node: a new approach for bioengineering complex organs Dental pulp stem cells: a new cellular resource for corneal stromal regeneration Nanosecond laser therapy reverses pathologic and molecular changes in age-related macular degeneration without retinal damage Brush-like polycarbonates containing dopamine, cations, and PEG providing a broad-spectrum, antibacterial, and antifouling surface via one-step coating Modeling the natural history of Pelizaeus–Merzbacher disease Common genetic variants influence human subcortical brain structures Transient delivery of modified mRNA encoding TERT rapidly extends telomeres in human cells Rapid formation of a supramolecular polypeptide–DNA hydrogel for in situ three-dimensional multilayer bioprinting Derivation of hair-inducing cell from human pluripotent stem cells KLRG+ invariant natural killer T cells are long-lived effectors Highly angiogenic peptide nanofibers Genome-wide functional analysis of CREB/long-term memory-dependent transcription reveals distinct basal and memory gene expression programs Differential prooxidative effects of the green tea polyphenol, (–)-epigallocatechin-3-gallate, in normal and oral cancer cells are related to differences in sirtuin 3 signaling FOXO1 promotes wound healing through the up-regulation of TGF-β1 and prevention of oxidative stress Foxo1 inhibits diabetic mucosal wound healing but enhances healing of normoglycemic wounds Agonist and antagonist switch DNA motifs recognized by human androgen receptor in prostate cancer Hematopoietic stem cell transplantation for MS--extraordinary evidence still needed Association of nonmyeloablative hematopoietic stem cell transplantation with neurological disability in patients with relapsing-remitting multiple sclerosis Vector design influences hepatic genotoxicity after adeno-associated virus gene therapy Human neural stem cell intracerebral grafts show spontaneous early neuronal differentiation after several weeks Human iPS cell-derived insulin producing cells form vascularized organoids under the kidney capsules of diabetic mice Multiple myeloma Systems genetics identifies Sestrin 3 as a regulator of a proconvulsant gene network in human epileptic hippocampus Time-resolved video analysis and management system for monitoring cardiomyocyte differentiation processes and toxicology assays An intermittent rocking platform for integrated expansion and differentiation of human pluripotent stem cells to cardiomyocytes in suspended microcarrier cultures Conjoint propagation and differentiation of human embryonic stem cells to cardiomyocytes in a defined microcarrier spinner culture Considerations in designing systems for large scale production of human cardiomyocytes from pluripotent stem cells A role of autophagy in PTP4A3-driven cancer progression Heterogeneity for IGF-II production maintained by public goods dynamics in neuroendocrine pancreatic cancer Loss of STAT3 in murine NK cells enhances NK cell–dependent tumor surveillance A dominant mutation in hexokinase 1 (HK1) causes retinitis pigmentosa Regulatory T cells suppress muscle inflammation and injury in muscular dystrophy Programming thermoresponsiveness of nanovelcro substrates enables effective purification of circulating tumor cells in lung cancer patients Megakaryocytes regulate hematopoietic stem cell quiescence through CXCL4 secretion Megakaryocytes maintain homeostatic quiescence and promote post-injury regeneration of hematopoietic stem cells Variation in the human immune system is largely driven by non-heritable influences Chimeric antigen receptor T Cells for sustained remissions in leukemia Mutations in PNPLA6 are linked to photoreceptor degeneration and various forms of childhood blindness Microfluidic device for stem cell differentiation and localized electroporation of postmitotic neurons Amplifying the red-emission of upconverting nanoparticles for biocompatible clinically used prodrug-induced photodynamic therapy Fast sorting of CD4+ T cells from whole blood using glass microbubbles DNA brick crystals with prescribed depths Clinical disease due to enterovirus D68 in adult hematologic malignancy patients and hematopoietic cell transplant recipients Gremlin 1 identifies a skeletal stem cell with bone, cartilage, and reticular stromal potential Vaccine-elicited CD4 T cells induce immunopathology after chronic LCMV infection Primate-specific endogenous retrovirus-driven transcription defines naive-like stem cells Association of COMT and TPH-2 genes with DSM-5 based PTSD symptoms Severity of age-related macular degeneration in 1 eye and the incidence and progression of age-related macular degeneration in the fellow eye Proteome profiling of breast cancer biopsies reveals a wound healing signature of cancer-associated fibroblasts Vascular channels formed by subpopulations of PECAM1+ melanoma cells Treatment of chronic graft-versus-host disease with bortezomib An α2-Na/K ATPase/α-adducin complex in astrocytes triggers non–cell autonomous neurodegeneration Generation of human striatal neurons by microRNA-dependent direct conversion of fibroblasts Murine and human tissue-engineered esophagus form from sufficient stem/progenitor cells and do not require microdesigned biomaterials EphA4 receptor shedding regulates spinal motor axon guidance The cavefish genome reveals candidate genes for eye loss Rapid modelling of cooperating genetic events in cancer through somatic genome editing Nanoparticle tension probes patterned at the nanoscale: impact of integrin clustering on force transmission DNA-based digital tension probes reveal integrin forces during early cell adhesion Insulin-like growth factor-1 stimulates regulatory T cells and suppresses autoimmune disease Actin stress in cell reprogramming CD8 T cells in innate immune responses: using STAT4-dependent but antigen-independent pathways to gamma interferon during viral infection Human iPSC-derived motoneurons harbouring TARDBP or C9ORF72 ALS mutations are dysfunctional despite maintaining viability Activated CD4+CCR5+ T cells in the rectum predict increased SIV acquisition in SIVGag/Tat-vaccinated rhesus macaques CD4 depletion in SIV-infected macaques results in macrophage and microglia infection with rapid turnover of infected cells Shedding of the tumor necrosis factor (TNF) receptor from the surface of hepatocytes during sepsis limits inflammation through cGMP signaling X chromosome reactivation dynamics reveal stages of reprogramming to pluripotency Innate lymphoid cells regulate intestinal epithelial cell glycosylation Quantitative SD-OCT imaging biomarkers as indicators of age-related macular degeneration progression BID mediates selective killing of APC-deficient cells in intestinal tumor suppression by nonsteroidal antiinflammatory drugs Dendrimer-encapsulated naphthalocyanine as a single agent-based theranostic nanoplatform for near-infrared fluorescence imaging and combinatorial anticancer phototherapy Engineered coiled-coil protein microfibers The e-incubator: a magnetic resonance imaging-compatible mini incubator Chronic hypertension increases susceptibility to acute IOP challenge in rats Adipose fatty acid oxidation is required for thermogenesis and potentiates oxidative stress-induced inflammation Postsurgical adjuvant tumor therapy by combining anti-angiopoietin-2 and metronomic chemotherapy limits metastatic growth Liver preservation with machine perfusion and a newly developed cell-free oxygen carrier solution under subnormothermic conditions Subnanometre-resolution electron cryomicroscopy structure of a heterodimeric ABC exporter Enteric bacteria promote human and mouse norovirus infection of B cells CDK7 inhibition suppresses super-enhancer-linked oncogenic transcription in MYCN-driven cancer Immortalization of normal human mammary epithelial cells in two steps by direct targeting of senescence barriers does not require gross genomic alterations Glycophorin C (CD236R) mediates vivax malaria parasite rosetting to normocytes Sirtuin 3 deficiency is associated with inhibited mitochondrial function and pulmonary arterial hypertension in rodents and humans Direct lineage conversion of adult mouse liver cells and B lymphocytes to neural stem cells Nanoparticle-mediated binning and profiling of heterogeneous circulating tumor cell subpopulations Transdifferentiation of human fibroblasts to endothelial cells: role of innate immunity Cell-size control and homeostasis in bacteria Comparable frequencies of coding mutations and loss of imprinting in human pluripotent cells derived by nuclear transfer and defined factors A biodegradable tri-component graft for anterior cruciate ligament reconstruction Crystal structure of Cas9 in complex with guide RNA and target DNA A prognostic score for acute graft-versus-host disease based on biomarkers: a multicentre study Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex Regional delivery of mesothelin-targeted CAR T cell therapy generates potent and long-lasting CD4-dependent tumor immunity Statin-induced mevalonate pathway inhibition attenuates the growth of mesenchymal-like cancer cells that lack functional E-cadherin mediated cell cohesion Combinatorial analysis of developmental cues efficiently converts human pluripotent stem cells into multiple neuronal subtypes Efficient ablation of genes in human hematopoietic stem and effector cells using CRISPR/Cas9 Dynamic acoustic field activated cell separation (DAFACS) An epigenomic roadmap to induced pluripotency reveals DNA methylation as a reprogramming modulator Proteome adaptation in cell reprogramming proceeds via distinct transcriptional networks Small RNA changes en route to distinct cellular states of induced pluripotency Divergent reprogramming routes lead to alternative stem-cell states Genome-wide characterization of the routes to pluripotency Synergy between Piezo1 and Piezo2 channels confers high-strain mechanosensitivity to articular cartilage Reduced IFNλ4 activity is associated with improved HCV clearance and reduced expression of interferon-stimulated genes Browning of human adipocytes requires KLF11 and reprogramming of PPARγ superenhancers Human genetics shape the gut microbiome Macrophages sense and kill bacteria through carbon monoxide–dependent inflammasome activation Restoration of progranulin expression rescues cortical neuron generation in an induced pluripotent stem cell model of frontotemporal dementia Short-term increases in transient receptor potential vanilloid-1 mediate stress-induced enhancement of neuronal excitation Latanoprost for open-angle glaucoma (UKGTS): a randomised, multicentre, placebo-controlled trial Global prevalence of glaucoma and projections of glaucoma burden through 2040 A Sox2 distal enhancer cluster regulates embryonic stem cell differentiation potential The common chymotrypsinogen C (CTRC) variant G60G (C.180T) increases risk of chronic pancreatitis but not recurrent acute pancreatitis in a North American population Inhibiting EGFR clustering and cell proliferation with gold nanoparticles Telomerase expression confers cardioprotection in the adult mouse heart after acute myocardial infarction Thy1 (CD90) controls adipogenesis by regulating activity of the Src family kinase, Fyn Functional Toll-like receptors in primary first-trimester trophoblasts Musashi proteins are post-transcriptional regulators of the epithelial-luminal cell state Risk factors for developing thyroid-associated ophthalmopathy among individuals with Graves disease Myeloid-derived suppressor activity is mediated by monocytic lineages maintained by continuous inhibition of extrinsic and intrinsic death pathways Oligodendrocyte precursor cells modulate the neuronal network by activity-dependent ectodomain cleavage of glial NG2 SNAIL-induced epithelial-to-mesenchymal transition produces concerted biophysical changes from altered cytoskeletal gene expression The progenitor state is maintained by lysine-specific demethylase 1-mediated epigenetic plasticity during Drosophila follicle cell development An essential role for senescent cells in optimal wound healing through secretion of PDGF-AA PINK1 deficiency impairs mitochondrial homeostasis and promotes lung fibrosis A Wnt-TGFβ2 axis induces a fibrogenic program in muscle stem cells from dystrophic mice Spatial quality control bypasses cell-based limitations on proteostasis to promote prion curing Prospective evaluation of teleophthalmology in screening and recurrence monitoring of neovascular age-related macular degeneration--a randomized clinical trial Stem cell transplantation as a dynamical system: are clinical outcomes deterministic? In silico derivation of HLA-specific alloreactivity potential from whole exome sequencing of stem-cell transplant donors and recipients: understanding the quantitative immunobiology of allogeneic transplantation Telomere position effect: regulation of gene expression with progressive telomere shortening over long distances Parkin sensitizes toward apoptosis induced by mitochondrial depolarization through promoting degradation of Mcl-1 Prostaglandin signaling suppresses beneficial microglial function in Alzheimer’s disease models Inhibition of pluripotency networks by the Rb tumor suppressor restricts reprogramming and tumorigenesis Cellular complexity captured in durable silica biocomposites Mechanically encoded cellular shapes for synthesis of anisotropic mesoporous particles Synthetic fossilization of soft biological tissues and their shape-preserving transformation into silica or electron-conductive replicas A nuclear F-actin scaffold stabilizes ribonucleoprotein droplets against gravity in large cells Restoration of visual function by expression of a light-gated mammalian ion channel in retinal ganglion cells or ON-bipolar cells Unencapsulated Streptococcus pneumoniae from conjunctivitis encode variant traits and belong to a distinct phylogenetic cluster Whole-mitochondrial genome sequencing in primary open-angle glaucoma using massively parallel sequencing identifies novel and known pathogenic variants Activation of toll-like receptor-2 by endogenous matrix metalloproteinase-2 modulates dendritic-cell-mediated inflammatory responses A conditional piggyBac transposition system for genetic screening in mice identifies oncogenic networks in pancreatic cancer Pharmacological protection of retinal pigmented epithelial cells by sulindac involves PPAR-α Deconstructing transcriptional heterogeneity in pluripotent stem cells Access to follicular dendritic cells is a pivotal step in murine chronic lymphocytic leukemia B-cell activation and proliferation Cancer exosomes perform cell-independent microRNA biogenesis and promote tumorigenesis Nanomimics of host cell membranes block invasion and expose invasive malaria parasites Age-related variations in the methylome associated with gene expression in human monocytes and T cells Topoisomerases facilitate transcription of long genes linked to autism Topoisomerase 1 inhibition reversibly impairs synaptic function Radiation protection of the gastrointestinal tract and growth inhibition of prostate cancer xenografts by a single compound Gene-gene and gene-environment interactions detected by transcriptome sequence analysis in twins Time-variant clustering model for understanding cell fate decisions Cell fate inclination within 2-cell and 4-cell mouse embryos revealed by single-cell RNA sequencing NanoScript: a nanoparticle-based artificial transcription factor for effective gene regulation CXCR4 and a cell-extrinsic mechanism control immature B lymphocyte egress from bone marrow The timing of upper-layer neurogenesis is conferred by sequential derepression and negative feedback from deep-layer neurons Aberrant calcium signaling by transglutaminase-mediated posttranslational modification of inositol 1,4,5-trisphosphate receptors Metabolic shifts toward glutamine regulate tumor growth, invasion and bioenergetics in ovarian cancer Nitric oxide mediates metabolic coupling of omentum-derived adipose to ovarian and endometrial cancer cells Somatic transcriptome priming gates lineage-specific differentiation potential of human-induced pluripotent stem cell states Human limbal biopsy–derived stromal stem cells prevent corneal scarring Stepwise visualization of membrane pore formation by suilysin, a bacterial cholesterol-dependent cytolysin Antigen affinity, costimulation, and cytokine inputs sum linearly to amplify T cell expansion Reliable generation of induced pluripotent stem cells from human lymphoblastoid cell lines Blocking PGE2-induced tumour repopulation abrogates bladder cancer chemoresistance Parallel T-cell cloning and deep sequencing of human MAIT cells reveal stable oligoclonal TCRβ repertoire Three-layered polyplex micelle as a multifunctional nanocarrier platform for light-induced systemic gene transfer SCNT-derived ESCs with mismatched mitochondria trigger an immune response in allogeneic hosts Selective conversion of fibroblasts into peripheral sensory neurons Modulation of the maladaptive stress response to manage diseases of protein folding Inorganic–organic hybrid nanoprobe for NIR-excited imaging of hydrogen sulfide in cell cultures and inflammation in a mouse model Nanoprobes: inorganic–organic hybrid nanoprobe for NIR-excited imaging of hydrogen sulfide in cell cultures and inflammation in a mouse model A subset of chondrogenic cells provides early mesenchymal progenitors in growing bones Nanosecond laser therapy reverses pathologic and molecular changes in age-related macular degeneration without retinal damage Panel-based genetic diagnostic testing for inherited eye diseases is highly accurate and reproducible, and more sensitive for variant detection, than exome sequencing The immune synapse clears and excludes molecules above a size threshold Long-term safety and efficacy of factor IX gene therapy in hemophilia B The angiogenic factor PlGF mediates a neuroimmune interaction in the spleen to allow the onset of hypertension PHD3 regulates EGFR internalization and signalling in tumours Loss of PHD3 allows tumours to overcome hypoxic growth inhibition and sustain proliferation through EGFR Targeting α4β7 integrin reduces mucosal transmission of simian immunodeficiency virus and protects gut-associated lymphoid tissue from infection An integrated catalog of reference genes in the human gut microbiome A rare human syndrome provides genetic evidence that WNT signaling is required for reprogramming of fibroblasts to induced pluripotent stem cells A proteome-scale map of the human interactome network Protein tyrosine phosphatase–σ regulates hematopoietic stem cell–repopulating capacity Metabotropic P2Y1 receptor signalling mediates astrocytic hyperactivity in vivo in an Alzheimer’s disease mouse model Phenylboronic acid modified mucoadhesive nanoparticle drug carriers facilitate weekly treatment of experimentallyinduced dry eye syndrome Spatial and temporal diversity in genomic instability processes defines lung cancer evolution Reversal of cognitive decline: A novel therapeutic program Maternal inflammation contributes to brain overgrowth and autism-associated behaviors through altered redox signaling in stem and progenitor cells The ion channel TRPV1 regulates the activation and proinflammatory properties of CD4+ T cells Combining random gene fission and rational gene fusion to discover near-infrared fluorescent protein fragments that report on protein–protein interactions Salivary gland cancer in BRCA-positive families--a retrospective review Magneto-fluorescent core-shell supernanoparticles Molecular convergence of neurodevelopmental disorders Stochastic variations of migration speed between cells in clonal populations A latent neurogenic program in astrocytes regulated by Notch signaling in the mouse PDGF-BB secreted by preosteoclasts induces angiogenesis during coupling with osteogenesis Life-long correction of hyperbilirubinemia with a neonatal liver-specific AAV-mediated gene transfer in a lethal mouse model of Crigler–Najjar Syndrome Direct cell–cell contact with the vascular niche maintains quiescent neural stem cells Clonal dynamics of native haematopoiesis Combined impact of healthy lifestyle factors on colorectal cancer: a large European cohort study A modified γ-retrovirus vector for X-linked severe combined immunodeficiency Cortical representations are reinstated by the hippocampus during memory retrieval Host cell entry of Middle East respiratory syndrome coronavirus after two-step, furin-mediated activation of the spike protein Gene expression-based enrichment of live cells from adipose tissue produces subpopulations with improved osteogenic potential Quality assurance in diabetic retinal screening in South Africa Mitochondrial haplogroups are associated with severity of diabetic retinopathy Preservation of genetic and regulatory robustness in ancient gene duplicates of Saccharomyces cerevisiae Gold nanoparticle-decellularized matrix hybrids for cardiac tissue engineering Nanoscale resistive switching in amorphous perovskite oxide (a-SrTiO3) memristors Control of embryonic stem cell identity by BRD4-dependent transcriptional elongation of super-enhancer-associated pluripotency genes Aromatic-turmerone induces neural stem cell proliferation in vitro and in vivo Solid-to-fluid DNA transition inside HSV-1 capsid close to the temperature of infection Solid-to-fluid–like DNA transition in viruses facilitates infection Pulmonary macrophage transplantation therapy Characterization of the molecular mechanisms underlying increased ischemic damage in the aldehyde dehydrogenase 2 genetic polymorphism using a human induced pluripotent stem cell model system Cellular heterogeneity in the mouse esophagus implicates the presence of a nonquiescent epithelial stem cell population Clinical cell therapy imaging using a perfluorocarbon tracer and fluorine-19 MRI Regulated assembly and disassembly of the yeast telomerase quaternary complex Anti-inflammatory therapy after selective laser trabeculoplasty Control of embryonic stem cell identity by BRD4-dependent transcriptional elongation of super-enhancer-associated pluripotency genes Bacterial quorum sensing molecule N-3-Oxo-Dodecanoyl-L-Homoserine Lactone causes direct cytotoxicity and reduced cell motility in human pancreatic carcinoma cells Pyrimidoindole derivatives are agonists of human hematopoietic stem cell self-renewal Delivery of antibody mimics into mammalian cells via anthrax toxin protective antigen PGC-1α mediates mitochondrial biogenesis and oxidative phosphorylation in cancer cells to promote metastasis Mutation of FOXC1 and PITX2 induces cerebral small-vessel disease Systematic discovery of novel ciliary genes through functional genomics in the zebrafish Dual modes of CLOCK:BMAL1 inhibition mediated by Cryptochrome and Period proteins in the mammalian circadian clock Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma Resetting transcription factor control circuitry toward ground-state pluripotency in human Hey1 and Hey2 control the spatial and temporal pattern of mammalian auditory hair cell differentiation downstream of Hedgehog signaling MicroRNAs control the apoptotic threshold in primed pluripotent stem cells through regulation of BIM The developmental potential of iPSCs is greatly influenced by reprogramming factor selection Enhanced re-endothelialization of acellular kidney scaffolds for whole organ engineering via antibody conjugation of vasculatures Specific roles for dendritic cell subsets during initiation and progression of psoriasis A 5-gene classifier from the carcinoma-associated fibroblast transcriptomic profile and clinical outcome in colorectal cancer The developmental potential of iPSCs is greatly influenced by reprogramming factor selection Histone variant H2A.X deposition pattern serves as a functional epigenetic mark for distinguishing the developmental potentials of iPSCs Substratum-induced differentiation of human pluripotent stem cells reveals the coactivator YAP is a potent regulator of neuronal specification PAX7 expression defines germline stem cells in the adult testis Reversal of diabetes with insulin-producing cells derived in vitro from human pluripotent stem cells Diversification of TAM receptor tyrosine kinase function Inhibition of JAK-STAT signaling stimulates adult satellite cell function Optical assay of erythrocyte function in banked blood The unfolded protein response triggers selective mRNA release from the endoplasmic reticulum Natively inhibited Trypanosoma brucei Cathepsin B structure determined by using an x-ray laser A potential wound-healing-promoting peptide from salamander skin Intracoronary cardiosphere-derived cells for heart regeneration after myocardial infarction (CADUCEUS): a prospective, randomised phase 1 trial Magnetic antibody-linked nanomatchmakers for therapeutic cell targeting Live human nasal epithelial cells (hNECs) on chip for in vitro testing of gaseous formaldehyde toxicity via airway delivery In vitro modeling of the neurovascular environment by coculturing adult human brain endothelial cells with human neural stem cells Mechanochemical actuators of embryonic epithelial contractility The effect of a connexin43-based peptide on the healing of chronic venous leg ulcers: a multicenter, randomized trial Loss and dysfunction of Vδ2+ γδ T cells are associated with clinical tolerance to malaria Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma Common variants near ABCA1 and in PMM2 are associated with primary open-angle glaucoma An implantable microfluidic device for self-monitoring of intraocular pressure Intrathecal gene therapy corrects CNS pathology in a feline model of mucopolysaccharidosis I An organized and functional thymus generated from FOXN1-reprogrammed fibroblasts Cell separation using tilted-angle standing surface acoustic waves Engineering patient-specific valves using stem cells generated from skin biopsy specimens Maresin-like lipid mediators are produced by leukocytes and platelets and rescue reparative function of diabetes-impaired macrophages Improvement in spinal cord injury-induced bladder fibrosis using mesenchymal stem cell transplantation into the bladder wall Breast cancer cells condition lymphatic endothelial cells within pre-metastatic niches to promote metastasis Assemblages: functional units formed by cellular phase separation A toxic RNA catalyzes the in cellulo synthesis of its own inhibitor UNC-6 (netrin) stabilizes oscillatory clustering of the UNC-40 (DCC) receptor to orient polarity 28-day intraocular pressure reduction with a single dose of brimonidine tartrate-loaded microspheres Dephosphorylation of tyrosine 393 in argonaute 2 by protein tyrosine phosphatase 1B regulates gene silencing in oncogenic RAS-induced senescence Molecular imaging reveals elevated VEGFR-2 expression in retinal capillaries in diabetes: a novel biomarker for early diagnosis Communication through resonance in spiking neuronal networks Bleb-driven chemotaxis of Dictyostelium cells How blebs and pseudopods cooperate during chemotaxis Native American ancestry is associated with severe diabetic retinopathy in Latinos Adipose derived stem cells and nerve regeneration Function of a Foxp3 cis-element in protecting regulatory T cell identity Use of differentiated pluripotent stem cells as replacement therapy for treating disease Synaptic dysregulation in a human iPS cell model of mental disorders Preparing the ground for tissue regeneration: from mechanism to therapy Partial restoration of cardiac function with ΔPDZ nNOS in aged mdx model of Duchenne cardiomyopathy Hand-held and integrated single-cell pipettes Generation of multipotent induced neural crest by direct reprogramming of human postnatal fibroblasts with a single transcription factor Detection of minimal residual disease in B lymphoblastic leukemia by high-throughput sequencing of IGH Integrin αvβ3 drives slug activation and stemness in the pregnant and neoplastic mammary gland Novel fusion transcripts associate with progressive prostate cancer Inhibition of Protein Phosphatase 2A (PP2A) prevents Mcl-1 protein dephosphorylation at the Thr-163/Ser-159 phosphodegron, dramatically reducing expression in Mcl-1-amplified lymphoma cells Sequential histone-modifying activities determine the robustness of transdifferentiation Collective and individual migration following the epithelial–mesenchymal transition Cytokinesis failure triggers Hippo tumor suppressor pathway activation Dissecting engineered cell types and enhancing cell fate conversion via CellNet CellNet: network biology applied to stem cell engineering The reprogramming of tumor stroma by HSF1 is a potent enabler of malignancy Forces driving epithelial wound healing Protein competition switches the function of COP9 from self-renewal to differentiation H3K4me3 breadth is linked to cell identity and transcriptional consistency Low-coverage single-cell mRNA sequencing reveals cellular heterogeneity and activated signaling pathways in developing cerebral cortex Interplay of matrix stiffness and protein tethering in stem cell differentiation Multimonth controlled small molecule release from biodegradable thin films Efficient CRISPR-Cas9–mediated genome editing in Plasmodium falciparum Development of an enhanced human gastrointestinal epithelial culture system to facilitate patient-based assays The role of stem cells in aesthetic surgery: fact or fiction? Induced neural stem cells achieve long-term survival and functional integration in the adult mouse brain Most genetic risk for autism resides with common variation Control of the survival and growth of human glioblastoma grafted into the spinal cord of mice by taking advantage of immunorejection Matrix softness regulates plasticity of tumour-repopulating cells via H3K9 demethylation and Sox2 expression Replication stress is a potent driver of functional decline in ageing haematopoietic stem cells Gene therapy enhances chemotherapy tolerance and efficacy in glioblastoma patients Inactivation of the human papillomavirus E6 or E7 gene in cervical carcinoma cells using a bacterial CRISPR/Cas RNA-guided endonuclease Silencing of the DNA mismatch repair gene MLH1 induced by hypoxic stress in a pathway dependent on the histone demethylase LSD1 Surviving extreme exposure to ionizing radiation: Escherichia coli genes and pathways Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1 RNA-directed gene editing specifically eradicates latent and prevents new HIV-1 infection Glycocalyx remodeling with proteoglycan mimetics promotes neural specification in embryonic stem cells The relationship of central foveal thickness to urinary iodine concentration in retinitis pigmentosa with or without cystoid macular edema Glial origin of mesenchymal stem cells in a tooth model system Schlemm's canal is a unique vessel with a combination of blood vascular and lymphatic phenotypes that forms by a novel developmental process Directing the behavior of active, self-oscillating gels with light Mesenchymal stem cells augment the adaptive response to eccentric exercise Highly efficient molecular delivery into mammalian cells using carbon nanotube spearing Molecular extraction in single live cells by sneaking in and out magnetic nanomaterials Prevalence of age-related macular degeneration in a large European cohort: Results from the population-based Gutenberg Health Study Non-cell-autonomous driving of tumour growth supports sub-clonal heterogeneity Network analysis of breast cancer progression and reversal using a tree-evolving network algorithm Heterogeneous tumor subpopulations cooperate to drive invasion Direct induction of haematoendothelial programs in human pluripotent stem cells by transcriptional regulators Cell-specific translational profiling in acute kidney injury Ex vivo culture of circulating breast tumor cells for individualized testing of drug susceptibility The E3 ligase PARC mediates the degradation of cytosolic cytochrome c to promote survival in neurons and cancer cells Relationship between leukocyte telomere length, telomerase activity, and hippocampal volume in early aging Bioengineering T cells to target carbohydrate to treat opportunistic fungal infection A plasmonic chip for biomarker discovery and diagnosis of type 1 diabetes Caspase-8 promotes NLRP1/NLRP3 inflammasome activation and IL-1β production in acute glaucoma ABCB5 is a limbal stem cell gene required for corneal development and repair Ultrahigh dose-rate FLASH irradiation increases the differential response between normal and tumor tissue in mice Histone chaperone ASF1A is required for maintenance of pluripotency and cellular reprogramming Ribosomal frameshifting in the CCR5 mRNA is regulated by miRNAs and the NMD pathway Human endothelial colony-forming cells serve as trophic mediators for mesenchymal stem cell engraftment via paracrine signaling Inhibitory interneuron progenitor transplantation restores normal learning and memory in ApoE4 knock-in mice without or with Aβ accumulation Kit regulates HSC engraftment across the human-mouse species barrier Gene therapy in patient-specific stem cell lines and a preclinical model of retinitis pigmentosa with membrane frizzled-related protein defects Effect of acetazolamide on visual function in patients with idiopathic intracranial hypertension and mild visual loss Pituitary tumor-transforming gene 1 regulates the patterning of retinal mosaics In vivo collective cell migration requires an LPAR2-dependent increase in tissue fluidity Two sides of the same coin: stem cells in cancer and regenerative medicine Leukemia propagating cells rebuild an evolving niche in response to therapy Rapamycin relieves lentiviral vector transduction resistance in human and mouse hematopoietic stem cells Abnormalities in human pluripotent cells due to reprogramming mechanisms Spatio‐temporally precise activation of engineered receptor tyrosine kinases by light Plasma biosignature and brain pathology related to persistent cognitive impairment in late-life depression Localized oncolytic virotherapy overcomes systemic tumor resistance to immune checkpoint blockade immunotherapy Three-dimensional cell migration does not follow a random walk Immune regulation by low doses of the DNA methyltransferase inhibitor 5-azacitidine in common human epithelial cancers Genetic analysis of tissue glutathione concentrations and redox balance A combined magnetophoresis/dielectrophoresis based microbead array as high-throughput biomolecular tweezers The transcription factor titration effect dictates level of gene expression The familial Alzheimer's disease APPV717I mutation alters APP processing and Tau expression in iPSC-derived neurons Galvanotactic control of collective cell migration in epithelial monolayers Systematic screen of chemotherapeutics in Drosophila stem cell tumors Common genetic variants modulate pathogen-sensing responses in human dendritic cells Serpins promote cancer cell survival and vascular co-option in brain metastasis Defining cell-type specificity at the transcriptional level in human disease Micropattern width dependent sarcomere development in human ESC-derived cardiomyocytes Vaccination with tumor cells expressing IL-15 and IL-15Rα inhibits murine breast and prostate cancer A dedicated circuit links direction-selective retinal ganglion cells to the primary visual cortex Clinical imaging in regenerative medicine Human immunodeficiency virus-1 tat protein increases the number of inhibitory synapses between hippocampal neurons in culture Cyclic AMP stimulates neurite outgrowth of lamprey reticulospinal neurons without substantially altering their biophysical properties Transendocardial mesenchymal stem cells and mononuclear bone marrow cells for ischemic cardiomyopathy Lymphomyeloid contribution of an immune-restricted progenitor emerging prior to definitive hematopoietic stem cells Increased cerebral activation after behavioral treatment for memory deficits in MS Let's rehabilitate cognitive rehabilitation in multiple sclerosis An RCT to treat learning impairment in multiple sclerosis: The MEMREHAB trial Wharton's jelly stem cells: A novel cell source for oral mucosa and skin epithelia regeneration A genome-wide association study identifies CDHR3 as a susceptibility locus for early childhood asthma with severe exacerbations Ossifying fibroma tumor stem cells are maintained by epigenetic regulation of a TSP1/TGF-β/SMAD3 autocrine loop Bovine lactoferricin B induces apoptosis of human gastric cancer cell line AGS by inhibition of autophagy at a late stage Genome-wide consequences of deleting any single gene Two decades of mortality trends among patients with severe sepsis: a comparative meta-analysis CO2 directly modulates connexin 26 by formation of carbamate bridges between subunits TH17 cell differentiation is regulated by the circadian clock Pediatric fecal microbiota harbor diverse and novel antibiotic resistance genes Commensal microbe-derived butyrate induces the differentiation of colonic regulatory T cells “Zero-dimensional” single-walled carbon nanotubes Reliable encoding of stimulus intensities within random sequences of intracellular Ca2+ spikes Filaments in curved streamlines: rapid formation of Staphylococcus aureus biofilm streamers Modeling a genetic risk for schizophrenia in iPSCs and mice reveals neural stem cell deficits associated with adherens junctions and polarity A role for intrathymic B cells in the generation of natural regulatory T cells miRNAs 182 and 183 are necessary to maintain adult cone photoreceptor outer segments and visual function Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization Type I interferons protect T cells against NK cell attack mediated by the activating receptor NCR1 IL-2–inducible T cell kinase tunes T regulatory cell development and is required for suppressive function Transcription factor induction of human oligodendrocyte progenitor fate and differentiation Dental pulp stem cells, a paracrine-mediated therapy for the retina Activity of broad-spectrum T cells as treatment for AdV, EBV, CMV, BKV, and HHV6 infections after HSCT Plasmonic gold nanoparticles modified titania nanotubes for antibacterial application Effect of marihuana on intraocular and blood pressure in glaucoma Marijuana smoking and reduced pressure in human eyes: drug action or epiphenomenon? A wireless intraocular pressure monitoring device with a solder-filled microchannel antenna Electrophysiological analysis of biopsy samples using elasticity as an inherent cell marker for cancer detection Cooperative, reversible self-assembly of covalently pre-linked proteins into giant fibrous structures A multiscale agent-based in silico model of liver fibrosis progression TRF2, but not TBP, mediates the transcription of ribosomal protein genes Dynamic changes in intracellular ROS levels regulate airway basal stem cell homeostasis through Nrf2-dependent notch signaling Direct Rho-associated kinase inhibition [correction of inhibiton] induces cofilin dephosphorylation and neurite outgrowth in PC-12 cells Transplantation of mesenchymal stem cells to the brain by topical application in an experimental traumatic brain injury model Stem cells in neuroinjury and neurodegenerative disorders: challenges and future neurotherapeutic prospects Cell therapy with G-CSF-mobilized stem cells in a rat osteoarthritis model CCL2 enhances pluripotency of human induced pluripotent stem cells by activating hypoxia related genes Autologous hematopoietic stem cell transplantation vs intravenous pulse cyclophosphamide in diffuse cutaneous systemic sclerosis: a randomized clinical trial Immunotherapy converts nonimmunogenic pancreatic tumors into immunogenic foci of immune regulation α-synuclein immunotherapy blocks uptake and templated propagation of misfolded α-synuclein and neurodegeneration The effects of intestinal tract bacterial diversity on mortality following allogeneic hematopoietic stem cell transplantation Lowest numbers of primary CD8+ T cells can reconstitute protective immunity upon adoptive immunotherapy Human ESC-derived MSCs outperform bone marrow MSCs in the treatment of an EAE model of Multiple Sclerosis Neuropathy of haematopoietic stem cell niche is essential for myeloproliferative neoplasms Efficient endoderm induction from human pluripotent stem cells by logically directing signals controlling lineage bifurcations Identification of specific cell-surface markers of adipose-derived stem cells from subcutaneous and visceral fat depots Introducing mixed-charge copolymers as wound dressing biomaterials Association between intensification of metformin treatment with insulin vs sulfonylureas and cardiovascular events and all-cause mortality among patients with diabetes Seamless modification of wild-type induced pluripotent stem cells to the natural CCR5Δ32 mutation confers resistance to HIV infection APOBEC-mediated cytosine deamination links PIK3CA helical domain mutations to human papillomavirus-driven tumor development Reactivation of multiple viruses in patients with sepsis Numerical modelling of a healthy/malaria-infected erythrocyte in shear flow using dissipative particle dynamics method Mechanisms of CFTR functional variants that impair regulated bicarbonate permeation and increase risk for pancreatitis but not for cystic fibrosis Aging-like phenotype and defective lineage specification in SIRT1-deleted hematopoietic stem and progenitor cells The nanoscale geometrical maturation of focal adhesions controls stem cell differentiation and mechanotransduction Antiviral activity of human OASL protein is mediated by enhancing signaling of the RIG-I RNA sensor Self-assembly of amphiphilic Janus dendrimers into uniform onion-like dendrimersomes with predictable size and number of bilayers Functional connectivity in the basal ganglia network differentiates PD patients from controls Cell-to-cell transfer of M. tuberculosis antigens optimizes CD4 T cell priming Mesenchymal stem cells increase hippocampal neurogenesis and neuronal differentiation by enhancing the Wnt signaling pathway in Alzheimer’s disease model Generation of three-dimensional retinal tissue with functional photoreceptors from human iPSCs Glutenase ALV003 attenuates gluten-induced mucosal injury in patients with celiac disease Seamless modification of wild-type induced pluripotent stem cells to the natural CCR5Δ32 mutation confers resistance to HIV infection Association between CD8+ T-cell infiltration and breast cancer survival in 12,439 patients Alcohol-related brain damage in humans Hyperactive Cdc2 kinase interferes with the response to broken replication forks by trapping S.pombe Crb2 in its mitotic T215 phosphorylated state Rare key functional domain missense substitutions in MRE11A, RAD50, and NBN contribute to breast cancer susceptibility: results from a Breast Cancer Family Registry case-control mutation-screening study Rare mutations in RINT1 predispose carriers to breast and lynch syndrome-spectrum cancers Prolonged fasting reduces IGF-1/PKA to promote hematopoietic-stem-cell-based regeneration and reverse immunosuppression Transplanted terminally differentiated induced pluripotent stem cells are accepted by immune mechanisms similar to self-tolerance High-fidelity reproduction of spatiotemporal visual signals for retinal prosthesis Nucleic acid sensing by T cells initiates Th2 cell differentiation Small molecule capture and release from PEI-functionalized single walled carbon nanotubes with endoscopic ultrasound Preparation and evaluation of polyethyleneimine-single walled carbon nanotube conjugates as vectors for pancreatic cancer treatment Mesenchymal stem cells, neural lineage potential, heparan sulfate proteoglycans and the matrix Photoactivation of endogenous latent transforming growth factor–β1 directs dental stem cell differentiation for regeneration Long-term health of dopaminergic neuron transplants in Parkinson's disease patients Microbial profiling of combat wound infection through detection microarray and next-generation sequencing Mutant huntingtin is present in neuronal grafts in huntington disease patients Generation of organized germ layers from a single mouse embryonic stem cell Prospective randomized phase 2 trial of intensity modulated radiation therapy with or without oncolytic adenovirus-mediated cytotoxic gene therapy in intermediate-risk prostate cancer Generation of a new therapeutic peptide that depletes myeloid-derived suppressor cells in tumor-bearing mice Identification of distinct ChAT+ neurons and activity-dependent control of postnatal SVZ neurogenesis Epigenomic comparison reveals activation of “seed” enhancers during transition from naive to primed pluripotency Reusable, robust, and accurate laser-generated photonic nanosensor Clinical grade allogeneic human mesenchymal stem cells restore alveolar fluid clearance in human lungs rejected for transplantation Aiolos promotes anchorage independence by silencing p66shc transcription in cancer cells Imatinib inhibits VEGF-independent angiogenesis by targeting neuropilin 1–dependent ABL1 activation in endothelial cells Brain pericytes acquire a microglial phenotype after stroke Molecular profiling of neurons based on connectivity Fluorogenic probes for live-cell imaging of the cytoskeleton The phosphorylation status of Ascl1 is a key determinant of neuronal differentiation and maturation in vivo and in vitro Multi-enzyme complexes on DNA scaffolds capable of substrate channelling with an artificial swinging arm A Trio–Rac1–Pak1 signalling axis drives invadopodia disassembly ALIX is recruited temporarily into HIV-1 budding sites at the end of Gag assembly Early microbial translocation blockade reduces SIV-mediated inflammation and viral replication Inhibition of mitochondrial protein import by mutant huntingtin Myelodysplastic syndromes are propagated by rare and distinct human cancer stem cells in vivo The dynamics of signaling as a pharmacological target Positive feedback within a kinase signaling complex functions as a switch mechanism for NF-κB activation Stem cells loaded with multimechanistic oncolytic herpes simplex virus variants for brain tumor therapy A centrifugal fluidic immunoassay for ocular diagnostics with an enzymatically hydrolyzed fluorogenic substrate Automated telecommunication-based reminders and adherence with once-daily glaucoma medication dosing: the automated dosing reminder study Electronic monitoring to assess adherence with once-daily glaucoma medications and risk factors for nonadherence: the automated dosing reminder study Ultrashort peptide nanofibrous hydrogels for the acceleration of healing of burn wounds The role of indoleamine 2,3 dioxygenase in beneficial effects of stem cells in hind limb ischemia reperfusion injury Cardiac BIN1 folds T-tubule membrane, controlling ion flux and limiting arrhythmia Transgene delivery via intracellular electroporetic nanoinjection A self-reconfiguring metamorphic nanoinjector for injection into mouse zygotes Precise patterning of silk microstructures using photolithography Silk protein lithography as a route to fabricate sericin microarchitectures Cancer immunotherapy based on mutation-specific CD4+ T cells in a patient with epithelial cancer Enhanced anticancer efficacy by ATP-mediated liposomal drug delivery Mesenchymal stem cells derived from adipose tissue vs bone marrow: in vitro comparison of their tropism towards gliomas Mesenchymal stem cells from human fat engineered to secrete BMP4 are nononcogenic, suppress brain cancer, and prolong survival 12-hydroxyheptadecatrienoic acid promotes epidermal wound healing by accelerating keratinocyte migration via the BLT2 receptor Rhbdf2 mutations increase its protein stability and drive EGFR hyperactivation through enhanced secretion of amphiregulin High-dose interleukin-2 therapy for metastatic renal cell carcinoma: a contemporary experience Modeling the mitochondrial cardiomyopathy of Barth syndrome with induced pluripotent stem cell and heart-on-chip technologies The histone methyltransferase activity of MLL1 is dispensable for hematopoiesis and leukemogenesis Functional outcome after anal sphincter injury and treatment with mesenchymal stem cells Single-cell RNA sequencing reveals T helper cells synthesizing steroids de novo to contribute to immune homeostasis Cell-state transitions regulated by SLUG are critical for tissue regeneration and tumor initiation Geographic atrophy--a histopathological assessment Clonal selection in the germinal centre by regulated proliferation and hypermutation Stretched cell cycle model for proliferating lymphocytes Metastatic ovarian cancer cell malignancy is increased on soft matrices through a mechanosensitive Rho/ROCK pathway A proliferative burst during preadolescence establishes the final cardiomyocyte number Expression of Nampt in hippocampal and cortical excitatory neurons is critical for cognitive function Specific ablation of Nampt in adult neural stem cells recapitulates their functional defects during aging Tear film dynamics with evaporation, wetting, and time-dependent flux boundary condition on an eye-shaped domain Deficits in bioenergetics and impaired immune response in granulocytes from children with autism Prevention and screening programs for anterior cruciate ligament injuries in young athletes Exosomes as critical agents of cardiac regeneration triggered by cell therapy Thermodynamic basis for engineering high-affinity, high-specificity binding-induced DNA clamp nanoswitches Temporal perturbation of the Wnt signaling pathway in the control of cell reprogramming is modulated by TCF1 Intracerebral implantation of autologous peripheral blood stem cells in stroke patients: a randomized phase II study Fate of iPSCs derived from azoospermic and fertile men following xenotransplantation to murine seminiferous tubules DNA Ligase I is not essential for mammalian cell viability APOBEC3A deaminates transiently exposed single-strand DNA during LINE-1 retrotransposition Bioreducible cationic polymer-based nanoparticles for efficient and environmentally triggered cytoplasmic siRNA delivery to primary human brain cancer cells Biodegradable polymeric nanoparticles show high efficacy and specificity at DNA delivery to human glioblastoma in vitro and in vivo A 3D sphere culture system containing functional polymers for large-scale human pluripotent stem cell production Astrocyte-encoded positional cues maintain sensorimotor circuit integrity Contact angle at the leading edge controls cell protrusion rate Enhancing adult nerve regeneration through the knockdown of retinoblastoma protein Crtc1 activates a transcriptional program deregulated at early Alzheimer's disease-related stages Large, stratified, and mechanically functional human cartilage grown in vitro by mesenchymal condensation Reprogramming committed murine blood cells to induced hematopoietic stem cells with defined factors Close-field electroporation gene delivery using the cochlear implant electrode array enhances the bionic ear Neurogenic potential of dental pulp stem cells isolated from murine incisors Tissue-resident natural killer (NK) cells are cell lineages distinct from thymic and conventional splenic NK cells Intestinal brush border assembly driven by protocadherin-based intermicrovillar adhesion Hydrogen sulfide maintains mesenchymal stem cell function and bone homeostasis via regulation of Ca2+ channel sulfhydration E3 ubiquitin ligase Cullin-5 modulates multiple molecular and cellular responses to heat shock protein 90 inhibition in human cancer cells An integrin β3–KRAS–RalB complex drives tumour stemness and resistance to EGFR inhibition A module of human peripheral blood mononuclear cell transcriptional network containing primitive and differentiation markers is related to specific cardiovascular health variables Modular extracellular sensor architecture for engineering mammalian cell-based devices RNA as a boiling-resistant anionic polymer material to build robust structures with defined shape and stoichiometry Regulatory interactions maintaining self-renewal of human embryonic stem cells as revealed through a systems analysis of P13K/AKT pathway Crosstalk and the evolution of specificity in two-component signaling In vivo adaptive optics microvascular imaging in diabetic patients without clinically severe diabetic retinopathy Neural stem cells genetically-modified to express neprilysin reduce pathology in Alzheimer transgenic models Hippo/YAP-mediated rigidity-dependent motor neuron differentiation of human pluripotent stem cells Extracellular O-linked N-acetylglucosamine is enriched in stem cells derived from human umbilical cord blood Total artificial heart in the pediatric patient with biventricular heart failure Tissue-engineered autologous vaginal organs in patients: a pilot cohort study Histone modification analysis by chromatin immunoprecipitation from a low number of cells on a microfluidic platform Association of a germline copy number polymorphism of APOBEC3A and APOBEC3B with burden of putative APOBEC-dependent mutations in breast cancer Experimental orthotopic transplantation of a tissue-engineered oesophagus in rats Reconstructing lineage hierarchies of the distal lung epithelium using single-cell RNA-seq Glaucoma – Diabetes of the brain: A radical hypothesis about its nature and pathogenesis Size evolution of highly amphiphilic macromolecular solution assemblies via a distinct bimodal pathway Three-dimensional printing of Hela cells for cervical tumor model in vitro Isolation of T cells from mouse oral tissues Designing bioinspired artificial cilia to regulate particle–surface interactions Engineered autologous cartilage tissue for nasal reconstruction after tumour resection: an observational first-in-human trial Carbon nanotube chemiresistor for wireless pH sensing p53 activity is selectively licensed in the Drosophila stem cell compartment Isolated nuclei adapt to force and reveal a mechanotransduction pathway in the nucleus The RhoA guanine nucleotide exchange factor, LARG, mediates ICAM-1–dependent mechanotransduction in endothelial cells to stimulate transendothelial migration Rif1 controls DNA replication timing in yeast through the PP1 phosphatase Glc7 SWELL1, a plasma membrane protein, is an essential component of volume-regulated anion channel Multifunctional wearable devices for diagnosis and therapy of movement disorders Pretreatment-dependent surface chemistry of wood nanocellulose for pH-sensitive hydrogels Reconstructing and reprogramming the tumor-propagating potential of glioblastoma stem-like cells Episodic binge ethanol exposure impairs murine macrophage infiltration and delays wound closure by promoting defects in early innate immune responses Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson’s Disease Meta-analysis of preclinical studies of mesenchymal stromal cells for ischemic stroke Estimating the effective density of engineered nanomaterials for in vitro dosimetry Disruption of the methyltransferase-like 23 gene METTL23 causes mild autosomal recessive intellectual disability Truncation of the E3 ubiquitin ligase component FBXO31 causes non-syndromic autosomal recessive intellectual disability in a Pakistani family Induction of human embryonic and induced pluripotent stem cells into urothelium Derivation of myogenic progenitors directly from human pluripotent stem cells using a sphere-based culture Hypoxia-inducible factors have distinct and stage-specific roles during reprogramming of human cells to pluripotency p53-mediated activation of the mitochondrial protease HtrA2/Omi prevents cell invasion Human embryonic stem cell derived islet progenitors mature inside an encapsulation device without evidence of increased biomass or cell escape Both contractile axial and lateral traction force dynamics drive amoeboid cell motility Epigenetic reprogramming of HOXC10 in endocrine-resistant breast cancer Gene therapy for Wiskott-Aldrich Syndrome—long-term efficacy and genotoxicity Transcripts involved in calcium signaling and telencephalic neuronal fate are altered in induced pluripotent stem cells from bipolar disorder patients IL-6R/STAT3/miR-34a feedback loop promotes EMT-mediated colorectal cancer invasion and metastasis Vulnerability of glioblastoma cells to catastrophic vacuolization and death induced by a small molecule A forward phenotypically driven unbiased genetic analysis of host genes that moderate herpes simplex virus virulence and stromal keratitis in mice Combination therapy of human umbilical cord blood cells and granulocyte colony stimulating factor reduces histopathological and motor impairments in an experimental model of chronic traumatic brain injury Transfection of the glial cell line-derived neurotrophic factor gene promotes neuronal differentiation Human finger-prick induced pluripotent stem cells facilitate the development of stem cell banking Cartilage tissue engineering application of injectable gelatin hydrogel with in situ visible-light-activated gelation capability in both air and aqueous solution An acellular biologic scaffold promotes skeletal muscle formation in mice and humans with volumetric muscle loss Perivascular stromal cells as a potential reservoir of human cytomegalovirus Nrf2 deficiency promotes apoptosis and impairs PAX7/MyoD expression in aging skeletal muscle cells Haematopoietic stem cells require a highly regulated protein synthesis rate Growth and proliferation of human embryonic stem cells on fully synthetic scaffolds based on carbon nanotubes Inhibition of miR-25 improves cardiac contractility in the failing heart Single-molecule analysis reveals human UV-damaged DNA-binding protein (UV-DDB) dimerizes on DNA via multiple kinetic intermediates A switch in the source of ATP production and a loss in capacity to perform glycolysis are hallmarks of hepatocyte failure in advance liver disease Pancreatic islet vasculature adapts to insulin resistance through dilation and not angiogenesis Vascular endothelial growth factor-A and islet vascularization are necessary in developing, but not adult, pancreatic islets Vascular endothelial growth factor coordinates islet innervation via vascular scaffolding Islet microenvironment, modulated by vascular endothelial growth factor-A signaling, promotes β cell regeneration De novo formation of insulin-producing “neo-β cell islets” from intestinal crypts Plasmonic interferometric sensor arrays for high-performance label-free biomolecular detection Single-cell analysis of K562 cells: An imatinib-resistant subpopulation is adherent and has upregulated expression of BCR-ABL mRNA and protein Ultraviolet-radiation-induced inflammation promotes angiotropism and metastasis in melanoma Two-photon-triggered drug delivery via fluorescent nanovalves Mouse liver repopulation with hepatocytes generated from human fibroblasts Robust nonenzymatic hybrid nanoelectrocatalysts for signal amplification toward ultrasensitive electrochemical cytosensing Magnetic field-induced T cell receptor clustering by nanoparticles enhances T cell activation and stimulates antitumor activity Restoring visual function to blind mice with a photoswitch that exploits electrophysiological remodeling of retinal ganglion cells A Photochromic Agonist for μ-Opioid Receptors The ecology in the hematopoietic stem cell niche determines the clinical outcome in chronic myeloid leukemia The familial Alzheimer's disease APPV717I mutation alters APP processing and Tau expression in iPSC-derived neurons The protein tyrosine phosphatase PTP1B is a negative regulator of CD40 and BAFF-R signaling and controls B cell autoimmunity Application of platelet-rich plasma and platelet-rich fibrin in fat grafting: basic science and literature review Live-cell imaging of alkyne-tagged small biomolecules by stimulated Raman scattering Central memory CD8+ T lymphocytes mediate lung allograft acceptance Responses of Staphylococcus aureus bacterial cells to nanocrystalline nickel nanostructures Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response Vitamin D hormone regulates serotonin synthesis. Part 1: relevance for autism Activation of multiple signaling pathways during the differentiation of mesenchymal stem cells cultured in a silicon nanowire microenvironment Imaging dynamic molecular signaling by the Cdc42 GTPase within the developing CNS Mechanism suppressing glycogen synthesis in neurons and its demise in progressive myoclonus epilepsy Glycogen accumulation underlies neurodegeneration and autophagy impairment in Lafora disease Neurons have an active glycogen metabolism that contributes to tolerance to hypoxia Transgenerational transmission of hyperactivity in a mouse model of ADHD Promoter-bound trinucleotide repeat mRNA drives epigenetic silencing in Fragile X Syndrome MicroRNAs located in the hox gene clusters are implicated in Huntington's disease pathogenesis Hypercaloric enteral nutrition in patients with amyotrophic lateral sclerosis: a randomised, double-blind, placebo-controlled phase 2 trial Hsp90-tau complex reveals molecular basis for specificity in chaperone action Cytoneme-mediated contact-dependent transport of the Drosophila decapentaplegic signaling protein Topical application of PPADS inhibits complement activation and choroidal neovascularization in a model of age-related macular degeneration Human iPSC-based modeling of late-onset disease via progerin-induced aging Silencing HoxA1 by intraductal injection of siRNA lipidoid nanoparticles prevents mammary tumor progression in mice Induced pluripotent stem cells from patients with human fibrodysplasia ossificans progressiva show increased mineralization and cartilage formation Calcium phosphate-bearing matrices induce osteogenic differentiation of stem cells through adenosine signaling An effective approach to prevent immune rejection of human ESC-derived allografts Antagonism of CD11b with neutrophil inhibitory factor (NIF) inhibits vascular lesions in diabetic retinopathy Requirement of NOX2 expression in both retina and bone marrow for diabetes-induced retinal vascular injury HIV-1 persistence in CD4+ T cells with stem cell–like properties Clot contraction: compression of erythrocytes into tightly packed polyhedra and redistribution of platelets and fibrin Transcriptome in vivo analysis (TIVA) of spatially defined single cells in live tissue Characterization and molecular profiling of PSEN1 familial Alzheimer's disease iPSC-derived neural progenitors Generation of iPSC lines from archived non-cryoprotected biobanked dura mater Long-term stability and safety of transgenic cultured epidermal stem cells in gene therapy of junctional epidermolysis bullosa Identification of novel human leukocyte antigen-A*0201-restricted, cytotoxic T lymphocyte epitopes on CD133 for cancer stem cell immunotherapy Retinal detachment after open globe injury Long-term safety and tolerability of ProSavin, a lentiviral vector-based gene therapy for Parkinson's disease: a dose escalation, open-label, phase 1/2 trial Cellular resolution maps of X chromosome inactivation: implications for neural development, function, and disease Patients’ attitudes toward the donation of biological materials for the derivation of induced pluripotent stem cells Engineering cells with intracellular agent–loaded microparticles to control cell phenotype Synergy between multiple microtubule-generating pathways confers robustness to centrosome-driven mitotic spindle formation Accurate prediction of drug-induced liver injury using stem cell-derived populations Collaborative care outcomes for pediatric behavioral health problems: a cluster randomized trial Early intervention to preempt major depression among older black and white adults Testing Turing’s theory of morphogenesis in chemical cells Novel processing of iron-manganese alloy-based biomaterials by inkjet 3-D printing Human placental trophoblasts confer viral resistance to recipient cells A randomized trial of protocol-based care for early septic shock Human muscle-derived stem/progenitor cells promote functional murine peripheral nerve regeneration Validation of cell-cycle arrest biomarkers for acute kidney injury using clinical adjudication Sialylneolacto-N-tetraose c (LSTc)-bearing liposomal decoys capture influenza A virus Autophagy variation within a cell population determines cell fate through selective degradation of Fap-1 Combinatorial effects of multiple enhancer variants in linkage disequilibrium dictate levels of gene expression to confer susceptibility to common traits Optogenetic stimulation of VTA dopamine neurons reveals that tonic but not phasic patterns of dopamine transmission reduce ethanol self-administration Human RPE stem cells grown into polarized RPE monolayers on a polyester matrix are maintained after grafting into rabbit subretinal space Autologous mesenchymal stromal cell infusion as adjunct treatment in patients with multidrug and extensively drug-resistant tuberculosis: an open-label phase 1 safety trial Feasibility of repairing glomerular basement membrane defects in Alport Syndrome Stem cell quiescence acts as a tumour suppressor in squamous tumours Glycolytic ATP fuels the plasma membrane calcium pump critical for pancreatic cancer cell survival Declining NAD+ induces a pseudohypoxic state disrupting nuclear-mitochondrial communication during aging Human natural killer cells prevent infectious mononucleosis features by targeting lytic Epstein-Barr virus infection Genome-wide recessive genetic screening in mammalian cells with a lentiviral CRISPR-guide RNA library Transcriptional targeting of primary and metastatic tumor neovasculature by an adenoviral type 5 roundabout4 vector in mice Smad1 and 5 but not Smad8 establish stem cell quiescence which is critical to transform the premature hair follicle during morphogenesis toward the postnatal state Competitive balance of intrabulge BMP/Wnt signaling reveals a robust gene network ruling stem cell homeostasis and cyclic activation Wnt7b is an important intrinsic regulator of hair follicle stem cell homeostasis and hair follicle cycling Adult rat retinal ganglion cells and glia can be printed by piezoelectric inkjet printing A UV-induced genetic network links the RSC complex to nucleotide excision repair and shows dose-dependent rewiring Mesothelin-specific chimeric antigen receptor mRNA-engineered T cells induce antitumor activity in solid malignancies Handheld ultrahigh speed swept source optical coherence tomography instrument using a MEMS scanning mirror Epithelial-to-mesenchymal transition enhances the cardioprotective capacity of human amniotic epithelial cells Targeting β-secretase with RNAi in neural stem cells for Alzheimer's disease therapy Rapid and efficient differentiation of human pluripotent stem cells into intermediate mesoderm that forms tubules expressing kidney proximal tubular markers Copper-transporting P-type ATPases use a unique ion-release pathway Genome-wide transcriptional analysis of differentially expressed genes in diabetic, healing corneal epithelial cells: hyperglycemia-suppressed TGFβ3 expression contributes to the delay of epithelial wound healing in diabetic corneas Human developmental chondrogenesis as a basis for engineering chondrocytes from pluripotent stem cells Silencing of RB1 and RB2/P130 during adipogenesis of bone marrow stromal cells results in dysregulated differentiation Giant Vesicle Arrays: A Simple and Versatile Method for the Formation of Arrays of Giant Vesicles with Controlled Size and Composition Sterilization of granulomas is common in active and latent tuberculosis despite within-host variability in bacterial killing Long-term efficient gene delivery using polyethylenimine with modified Tat peptide Prevention of inflammation-mediated bone loss in murine and canine periodontal disease via recruitment of regulatory lymphocytes Abortive HIV infection mediates CD4 T cell depletion and inflammation in human lymphoid tissue IFI16 DNA sensor is required for death of lymphoid CD4 T cells abortively infected with HIV Cell death by pyroptosis drives CD4 T-cell depletion in HIV-1 infection Epithelial bridges maintain tissue integrity during collective cell migration In vivo reprogramming of adult somatic cells to pluripotency by overexpression of Yamanaka factors Co-culture with mesenchymal stem cells results in improved viability and function of human hepatocytes Distinct fibroblast lineages determine dermal architecture in skin development and repair Adding spatial control to click chemistry: phototriggered diels–alder surface (bio)functionalization at ambient temperature (Bio)molecular surface patterning by phototriggered oxime ligation Spatially controlled surface immobilization of nonmodified peptides Spatially controlled surface immobilization of nucleophiles via trapping of photo-generated thioaldehydes Three-dimensional microscaffolds exhibiting spatially resolved surface chemistry Controlled cell adhesion on poly(dopamine) interfaces photopatterned with non-fouling brushes Cell-cycle control of developmentally regulated transcription factors accounts for heterogeneity in human pluripotent cells Salmonella Typhimurium impedes innate immunity with a mast-cell-suppressing protein tyrosine phosphatase, SptP Pre- and postnatal transplantation of fetal mesenchymal stem cells in osteogenesis imperfecta: a two-center experience Sustained complete responses in patients with lymphoma receiving autologous cytotoxic T lymphocytes targeting Epstein-Barr Virus latent membrane proteins Stem cell transplantation in traumatic spinal cord injury: a systematic review and meta-analysis of animal studies Targeted therapy resistance mediated by dynamic regulation of extrachromosomal mutant EGFR DNA It’s time to bring dendritic cell therapy to type 1 diabetes Fluphenazine reduces proteotoxicity in C. elegans and mammalian models of Alpha-1-antitrypsin deficiency Electrically controlled drug delivery from graphene oxide nanocomposite films Decellularized allogeneic and xenogeneic tissue as a bioscaffold for regenerative medicine: factors that influence the host response Frequent mutation of receptor protein tyrosine phosphatases provides a mechanism for STAT3 hyperactivation in head and neck cancer Biologically derived melanin electrodes in aqueous sodium-ion energy storage devices Reaction-based fluorescent sensor for investigating mobile Zn2+ in mitochondria of healthy versus cancerous prostate cells Marker-free phenotyping of tumor cells by fractal analysis of reflection interference contrast microscopy images Quantifying cell-generated mechanical forces within living embryonic tissues Unmasking the roles of N- and C-terminal flanking sequences from exon 1 of huntingtin as modulators of polyglutamine aggregation Platelet-targeted gene therapy with human factor VIII establishes haemostasis in dogs with haemophilia A PKM2 regulates chromosome segregation and mitosis progression of tumor cells Antiviral treatment for hepatitis C virus infection is associated with improved renal and cardiovascular outcomes in diabetic patients Transcranial amelioration of inflammation and cell death after brain injury Mapping eQTLs in the Norfolk Island genetic isolate identifies candidate genes for CVD risk traits Restoration of testis function in hypogonadotropic hypogonadal mice harboring a misfolded GnRHR mutant by pharmacoperone drug therapy Motor excitability during movement preparation in Tourette syndrome In vivo performance of a drug-eluting contact lens to treat glaucoma for a month A special population of regulatory T cells potentiates muscle repair Distinct functions for Wnt/β-catenin in hair follicle stem cell proliferation and survival and interfollicular epidermal homeostasis Histology of CorMatrix bioscaffold 5 Years after pericardial closure APP processing in human pluripotent stem cell-derived neurons is resistant to NSAID-based γ-secretase modulation Gata2 cis-element is required for hematopoietic stem cell generation in the mammalian embryo Strategies for expanding the operational range of channelrhodopsin in optogenetic vision Structural basis for Ca2+ selectivity of a voltage-gated calcium channel Nanowell-trapped charged ligand-bearing nanoparticle surfaces: a novel method of enhancing flow-resistant cell adhesion c-Met-dependent multipotent labyrinth trophoblast progenitors establish placental exchange interface Contractile forces sustain and polarize hematopoiesis from stem and progenitor cells High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy Niche-independent high-purity cultures of Lgr5+ intestinal stem cells and their progeny Sca1-derived cells are a source of myocardial renewal in the murine adult heart Lysosomal NEU1 deficiency affects amyloid precursor protein levels and amyloid-β secretion via deregulated lysosomal exocytosis The intestinal microbiota modulates the anticancer immune effects of cyclophosphamide Commensal bacteria control cancer response to therapy by modulating the tumor microenvironment Efficient generation of lung and airway epithelial cells from human pluripotent stem cells Role of SWI/SNF in acute leukemia maintenance and enhancer-mediated Myc regulation Analysis of serum inflammatory mediators identifies unique dynamic networks associated with death and spontaneous survival in pediatric acute liver failure Characterization of a biodegradable coralline hydroxyapatite/calcium carbonate composite and its clinical implementation Microbial colonization influences early B-lineage development in the gut lamina propria Auto-attraction of neural precursors and their neuronal progeny impairs neuronal migration EMRE is an essential component of the mitochondrial calcium uniporter complex Deficits in adult neurogenesis, contextual fear conditioning, and spatial learning in a Gfap mutant mouse model of Alexander disease Metabolically active human brown adipose tissue derived stem cells Mitochondrial retrograde signaling induces epithelial–mesenchymal transition and generates breast cancer stem cells Human Treg responses allow sustained recombinant adeno-associated virus–mediated transgene expression Design and formulation of functional pluripotent stem cell-derived cardiac microtissues HiRIEF LC-MS enables deep proteome coverage and unbiased proteogenomics The presenilin-1 ΔE9 mutation results in reduced -γsecretase activity, but not total loss of PS1 function, in isogenic human stem cells Chromosomal contact permits transcription between coregulated genes Directed differentiation of human pluripotent cells to ureteric bud kidney progenitor-like cells Ammonia triggers neuronal disinhibition and seizures by impairing astrocyte potassium buffering Ultrasound-triggered regulation of blood glucose levels using injectable nano-network CD137 accurately identifies and enriches for naturally-occurring tumor-reactive T cells in tumor Beta cell dysfunction due to increased ER stress in a stem cell model of Wolfram syndrome Activated ClpP kills persisters and eradicates a chronic biofilm infection The BET family of proteins targets moloney murine leukemia virus integration near transcription start sites Parvalbumin interneurons mediate neuronal circuitry–neurogenesis coupling in the adult hippocampus Tension-oriented cell divisions limit anisotropic tissue tension in epithelial spreading during zebrafish epiboly SERCA2a controls the mode of agonist-induced intracellular Ca2+ signal, transcription factor NFAT and proliferation in human vascular smooth muscle cells SUMO1-dependent modulation of SERCA2a in heart failure SUMO-1 gene transfer improves cardiac function in a large-animal model of heart failure The cytotoxic necrotizing factor of Yersinia pseudotuberculosis (CNFY) enhances inflammation and Yop delivery during infection by activation of Rho GTPases Psychobiotics: a novel class of psychotropic Two-wave nanotherapy to target the stroma and optimize gemcitabine delivery to a human pancreatic cancer model in mice JUNB/AP-1 controls IFN-γ during inflammatory liver disease Human induced pluripotent stem cell-derived cortical neurons integrate in stroke-injured cortex and improve functional recovery Spherical nucleic acid nanoparticle conjugates as an RNAi-based therapy for glioblastoma Sorafenib/regorafenib and phosphatidyl inositol 3 kinase/thymoma viral proto-oncogene inhibition interact to kill tumor cells Intravenous multipotent adult progenitor cell therapy attenuates activated microglial/macrophage response and improves spatial learning after traumatic brain injury Computed tomography-guided tissue engineering of equine upper airway cartilage Nanotechnology in the regulation of stem cell behavior Exome sequencing identifies distinct mutational patterns in liver fluke–related and non-infection-related bile duct cancers Enrichment of human prostate cancer cells with tumor initiating properties in mouse and zebrafish xenografts by differential adhesion Histone deacetylase 3 coordinates commensal-bacteria-dependent intestinal homeostasis Social stress up-regulates inflammatory gene expression in the leukocyte transcriptome via β-adrenergic induction of myelopoiesis Autologous transplantation as consolidation for aggressive non-hodgkin's lymphoma Differentiated kidney epithelial cells repair injured proximal tubule Plasmapheresis eliminates the negative impact of AAV antibodies on micro-dystrophin gene expression following vascular delivery A genetic and developmental pathway from STAT3 to the OCT4–NANOG circuit is essential for maintenance of ICM lineages in vivo Fiber-optic two-photon optogenetic stimulation Identification and rescue of α-synuclein toxicity in Parkinson patient–derived neurons Yeast reveal a “druggable” Rsp5/Nedd4 network that ameliorates α-synuclein toxicity in neurons Protein phosphatase 4 and Smek complex negatively regulate Par3 and promote neuronal differentiation of neural stem/progenitor cells Elongation of the C-terminal domain of an anti-amyloid β single-chain variable fragment increases its thermodynamic stability and decreases its aggregation tendency Early intervention in the 3xTg-AD mice with an amyloid β-antibody fragment ameliorates first hallmarks of Alzheimer disease Loss of deep cerebellar nuclei neurons in the 3xTg-AD mice and protection by an anti-amyloid β antibody fragment High-throughput fingerprinting of human pluripotent stem cell fate responses and lineage bias Targeted deletion of Vegfa in adult mice induces vision loss Ras pathway inhibition prevents neovascularization by repressing endothelial cell sprouting Quantitative transcriptomics using designed primer-based amplification Harnessing interfacially-active nanorods to regenerate severed polymer gels Genome-wide association study of obsessive-compulsive disorder Genome-wide association study of Tourette's syndrome Partitioning the heritability of Tourette syndrome and obsessive compulsive disorder reveals differences in genetic architecture Failure of stem cell therapy to improve visual acuity in children with optic nerve hypoplasia Thymic stromal lymphopoietin induces corticosteroid resistance in natural helper cells during airway inflammation Positional information is reprogrammed in blastema cells of the regenerating limb of the Axolotl (Ambystoma mexicanum) Molecular mechanisms of cellular mechanosensing Magneto-electric nanoparticles to enable field-controlled high-specificity drug delivery to eradicate ovarian cancer cells Targeting RNA foci in iPSC-derived motor neurons from ALS patients with a C9ORF72 repeat expansion Transplantation of expanded fetal intestinal progenitors contributes to colon regeneration after injury Biophysical regulation of epigenetic state and cell reprogramming A nanopore machine promotes the vectorial transport of DNA across membranes SCRIB and PUF60 are primary drivers of the multisystemic phenotypes of the 8q24.3 copy-number variant Transplantation of expanded fetal intestinal progenitors contributes to colon regeneration after injury Pulse wave velocity is associated with β-amyloid deposition in the brains of very elderly adults Recombinant AAV-mediated BEST1 transfer to the retinal pigment epithelium: analysis of serotype-dependent retinal effects Relationship between 17-alpha hydroxyprogesterone caproate concentration and spontaneous preterm birth Weight change and health outcomes at 3 years after bariatric surgery among individuals with severe obesity Smurf2 regulates the senescence response and suppresses tumorigenesis in mice Smurf2 suppresses B-cell proliferation and lymphomagenesis by mediating ubiquitination and degradation of YY1 Multifunctional nanomedicine platform for concurrent delivery of chemotherapeutic drugs and mild hyperthermia to ovarian cancer cells Lower HIV provirus levels are associated with more APOBEC3G protein in blood resting memory CD4+ T lymphocytes Dielectrophoresis-based discrimination of bacteria at the strain level based on their surface properties Early outgrowth cells release soluble endocrine anti-fibrotic factors that reduce progressive organ fibrosis Cancer cell exosomes depend on cell-surface heparan sulfate proteoglycans for their internalization and functional activity DGIdb: mining the druggable genome Genome-wide sequencing of cellular microRNAs identifies a combinatorial expression signature diagnostic of sepsis RNA toxicity from the ALS/FTD C9ORF72 expansion is mitigated by antisense intervention SLIT3–ROBO4 activation promotes vascular network formation in human engineered tissue and angiogenesis in vivo Cytoplasmic genetic variation and extensive cytonuclear interactions influence natural variation in the metabolome Automatic diagnosis of pathological myopia from heterogeneous biomedical data Identification of neural connectivity signatures of autism using machine learning Spatial organization within a niche as a determinant of stem-cell fate Differentiated troy+ chief cells act as reserve stem cells to generate all lineages of the stomach epithelium Sustained release of bone morphogenetic protein 2 via coacervate improves the osteogenic potential of muscle-derived stem cells Prevention of inflammation-mediated bone loss in murine and canine periodontal disease via recruitment of regulatory lymphocytes Sox2+ stem/progenitor cells in the adult mouse pituitary support organ homeostasis and have tumor-inducing potential Induction and suppression of RNA silencing by an animal virus Antiviral RNA interference in mammalian cells RNA interference functions as an antiviral immunity mechanism in mammals Variants at multiple loci implicated in both innate and adaptive immune responses are associated with Sjögren's syndrome DNMT1-interacting RNAs block gene-specific DNA methylation Spontaneous lytic replication and epitheliotropism define an Epstein-Barr virus strain found in carcinomas Retinal proteome alterations in a mouse model of type 2 diabetes Klotho regulates retinal pigment epithelial functions and protects against oxidative stress Mammalian cells preferentially internalize hydrogel nanodiscs over nanorods and use shape-specific uptake mechanisms An erythroid enhancer of BCL11A subject to genetic variation determines fetal hemoglobin level Aberrant dolichol chain lengths as biomarkers for retinitis pigmentosa caused by impaired dolichol biosynthesis The housekeeping gene hypoxanthine guanine phosphoribosyltransferase (HPRT) regulates multiple developmental and metabolic pathways of murine embryonic stem cell neuronal differentiation Oncogenic RAS directs silencing of tumor suppressor genes through ordered recruitment of transcriptional repressors 5-HT2 receptors facilitate JC polyomavirus entry Induction of multipotential hematopoietic progenitors from human pluripotent stem cells via respecification of lineage-restricted precursors Cross talk between Wnt/β-catenin and Irf8 in leukemia progression and drug resistance Integrative annotation of variants from 1092 humans: application to cancer genomics Addiction of t(8;21) and inv(16) acute myeloid leukemia to native RUNX1 Dendritic epidermal T cells regulate skin antimicrobial barrier function Defining cell-type specificity at the transcriptional level in human disease How allosteric control of Staphylococcus aureus penicillin binding protein 2a enables methicillin resistance and physiological function Simple, inexpensive technique for high-quality Smartphone fundus photography in human and animal eyes Identifying division symmetry of mouse embryonic stem cells: negative impact of DNA methyltransferases on symmetric self-renewal Directional tissue migration through a self-generated chemokine gradient Direct comparison of autologous and allogeneic transplantation of iPSC-derived neural cells in the brain of a nonhuman primate CMX001 to prevent cytomegalovirus disease in hematopoietic-cell transplantation Pan-cancer patterns of somatic copy number alteration Paneth cells as a site of origin for intestinal inflammation mRNA-engineered mesenchymal stem cells for targeted delivery of interleukin-10 to sites of inflammation With an eye to low vision: optic flow enables perception despite image blur The epithelial cell-derived atopic dermatitis cytokine TSLP activates neurons to induce itch Mitochondrial genetic background modulates bioenergetics and susceptibility to acute cardiac volume overload Early human prostate adenocarcinomas harbor androgen-independent cancer cells Deterministic direct reprogramming of somatic cells to pluripotency Helicobacter pylori infection in a pig model is dominated by Th1 and cytotoxic CD8+ T cell responses Epigenetic control of natural killer cell maturation by histone H2A deubiquitinase, MYSM1 Scalable spray deposition process for high-performance carbon nanotube gas sensors Flexible carbon nanotube based gas sensors fabricated by large-scale spray deposition Fabrication of carbon nanotube thin films on flexible substrates by spray deposition and transfer printing Glassy dynamics in three-dimensional embryonic tissues Targeting sonic hedgehog-associated medulloblastoma through inhibition of aurora and polo-like kinases Unlimited in vitro expansion of adult bi-potent pancreas progenitors through the Lgr5/R-spondin axis Generation of effector memory T cell–based mucosal and systemic immunity with pulmonary nanoparticle vaccination Genetically dictated change in host mucus carbohydrate landscape exerts a diet-dependent effect on the gut microbiota Whole genome sequencing in patients with retinitis pigmentosa reveals pathogenic DNA structural changes and NEK2 as a new disease gene Smart-seq2 for sensitive full-length transcriptome profiling in single cells Biochemical and physical signal gradients in hydrogels to control stem cell behavior Single-cell Hi-C reveals cell-to-cell variability in chromosome structure Multifocal pupillography identifies retinal dysfunction in early age-related macular degeneration Macrophage phenotype in the mammary gland fluctuates over the course of the estrous cycle and is regulated by ovarian steroid hormones Hippocampal interneuron transplants reverse aberrant dopamine system function and behavior in a rodent model of schizophrenia Reprogramming in vivo produces teratomas and iPS cells with totipotency features Targeted delivery of proapoptotic peptides to tumor-associated macrophages improves survival CDK8-mediated STAT1-S727 phosphorylation restrains NK cell cytotoxicity and tumor surveillance Usp16 contributes to somatic stem-cell defects in Down’s syndrome Initiation of GalNAc-type O-glycosylation in the endoplasmic reticulum promotes cancer cell invasiveness Network-based stratification of tumor mutations Activated EGFR stimulates MUC1 expression in human uterine and pancreatic cancer cell lines An experimental test on the probability of extinction of new genetic variants Retinal angiogenesis suppression through small molecule activation of p53 Identification of a rare coding variant in complement 3 associated with age-related macular degeneration A genome-wide RNAi screen reveals determinants of human embryonic stem cell identity SON connects the splicing-regulatory network with pluripotency in human embryonic stem cells Human circulating PD-1+CXCR3CXCR5+ memory Tfh cells are highly functional and correlate with broadly neutralizing HIV antibody responses Physical clustering of FLC alleles during Polycomb-mediated epigenetic silencing in vernalization Early role for IL-6 signalling during generation of induced pluripotent stem cells revealed by heterokaryon RNA-Seq Superpixel classification based optic disc and optic cup segmentation for glaucoma screening Age of the donor reduces the ability of human adipose-derived stem cells to alleviate symptoms in the experimental autoimmune encephalomyelitis mouse model Defining the disease liability of variants in the cystic fibrosis transmembrane conductance regulator gene Genome engineering of drosophila with the CRISPR RNA-guided Cas9 nuclease Effects of sleep and wake on oligodendrocytes and their precursors Mechanism-based epigenetic chemosensitization therapy of diffuse large B-cell lymphoma Cellular and synaptic architecture of multisensory integration in the mouse neocortex Functional consequences of platelet binding to T lymphocytes in inflammation Cardiolipin externalization to the outer mitochondrial membrane acts as an elimination signal for mitophagy in neuronal cells Enrichment of autologous fat grafts with ex-vivo expanded adipose tissue-derived stem cells for graft survival: a randomised placebo-controlled trial Adipose stem cell therapy for soft tissue reconstruction Technology, trends, and the future for people with spinal cord injury The p130 isoform of angiomotin is required for Yap-mediated hepatic epithelial cell proliferation and tumorigenesis Probing red blood cell morphology using high-frequency photoacoustics In vitro study of α-synuclein protofibrils by cryo-EM suggests a Cu2+-dependent aggregation pathway Nuclear lamin-A scales with tissue stiffness and enhances matrix-directed differentiation Increasing the complexity of chromatin: functionally distinct roles for replication-dependent histone H2A isoforms in cell proliferation and carcinogenesis Stomach cancer risk after treatment for Hodgkin lymphoma Immunotherapy of chronic hepatitis C virus infection with antibodies against programmed cell death-1 (PD-1) Tunable and multifunctional eukaryotic transcription factors based on CRISPR/Cas Eukaryotic stress granules are cleared by autophagy and Cdc48/VCP function Induced pluripotent stem cell intervention rescues ventricular wall motion disparity, achieving biological cardiac resynchronization post-infarction In situ regulation of DC subsets and T cells mediates tumor regression in mice The pseudokinase MLKL mediates necroptosis via a molecular switch mechanism Purification of cardiomyocytes from differentiating pluripotent stem cells using molecular beacons targeting cardiomyocyte-specific mRNA Migraine and structural changes in the brain: A systematic review and meta-analysis Genetic basis for in vivo daptomycin resistance in enterococci Daptomycin-resistant Enterococcus faecalis diverts the antibiotic molecule from the division septum and remodels cell membrane phospholipids Chemoprevention of prostate cancer by D,L-sulforaphane is augmented by pharmacological inhibition of autophagy Blocking macrophage leukotriene B4 prevents endothelial injury and reverses pulmonary hypertension What can information-asymmetric games tell us about the context of Crick's ‘frozen accident’? Topoisomerases facilitate transcription of long genes linked to autism Self-assembled carbon nanotube honeycomb networks using a butterfly wing template as a multifunctional nanobiohybrid GATA-3 regulates the self-renewal of long-term hematopoietic stem cells Low-dose food contaminants trigger sex-specific, hepatic metabolic changes in the progeny of obese mice Two cells are better than one: Optimizing stem cell survival by co-grafting “helper” cells that offer regulated trophic support Neural progenitor cell survival in mouse brain can be improved by co-transplantation of helper cells expressing bFGF under doxycycline control Notch1 is required for Kras-induced lung adenocarcinoma and controls tumor cell survival via p53 Generation and characterization of spiking and non-spiking oligodendroglial progenitor cells from embryonic stem cells Molecular mechanism for age-related memory loss: the histone-binding protein RbAp48 PET/MRI: applications in clinical imaging Richness of human gut microbiome correlates with metabolic markers Ether lipid generating enzyme AGPS alters the balance of structural and signaling lipids to fuel cancer pathogenicity A new role for histone deacetylase 5 in the maintenance of long telomeres Potential protective effect of biphasic electrical stimulation against growth factor-deprived apoptosis on olfactory bulb neural progenitor cells through the brain-derived neurotrophic factor–phosphatidylinositol 3′-kinase/Akt pathway Cerebral organoids model human brain development and microcephaly IRF4 transcription factor-dependent CD11b+ dendritic cells in human and mouse control mucosal IL-17 cytokine responses A nanobody-based system using fluorescent proteins as scaffolds for cell-specific gene manipulation Heparan sulfate proteoglycans mediate internalization and propagation of specific proteopathic seeds Global comparisons of lectin-glycan interactions using a database of analyzed glycan array data Specific glycoforms of MUC5AC and endorepellin accurately distinguish mucinous from non-mucinous pancreatic cysts Marine omega-3 polyunsaturated fatty acids induce sex-specific changes in reinforcer-controlled behaviour and neurotransmitter metabolism in a spontaneously hypertensive rat model of ADHD Exome sequencing identifies recurring FLT3 N676K mutations in core-binding factor leukemia Long-term suppression of ocular neovascularization by intraocular injection of biodegradable polymeric particles containing a serpin-derived peptide Transplantation of human fetal-derived neural stem cells improves cognitive function following cranial irradiation Deacetylase inhibition promotes the generation and function of regulatory T cells Inhibition of p300 impairs Foxp3+ T regulatory cell function and promotes antitumor immunity Patterned prevascularised tissue constructs by assembly of polyelectrolyte hydrogel fibres Functional vascular endothelium derived from human induced pluripotent stem cells Fruit and vegetable intakes are associated with lower risk of bladder cancer among women in the multiethnic cohort study A multi-stakeholder perspective on the use of alternative test strategies for nanomaterial safety assessment Molecular crowding shapes gene expression in synthetic cellular nanosystems Mortality among patients admitted to strained intensive care units In vivo reprogramming of murine cardiac fibroblasts into induced cardiomyocytes Direct reprogramming of human fibroblasts toward a cardiomyocyte-like state Autophagy activation clears ELAVL1/HuR-mediated accumulation of SQSTM1/p62 during proteasomal inhibition in human retinal pigment epithelial cells Mesenchymal stem cells enhance the engraftment and myelinating ability of allogeneic oligodendrocyte progenitors in dysmyelinated mice Clinical and pathological effects of intrathecal injection of mesenchymal stem cell-derived neural progenitors in an experimental model of multiple sclerosis Characterization of autologous mesenchymal stem cell-derived neural progenitors as a feasible source of stem cells for central nervous system applications in multiple sclerosis Cerebrospinal fluid derived from progressive multiple sclerosis patients promotes neuronal and oligodendroglial differentiation of human neural precursor cells in vitro Plasma lipids, genetic variants near APOA1, and the risk of infantile hypertrophic pyloric stenosis MC1R is a potent regulator of PTEN after UV exposure in melanocytes Population-based prognostic factors for survival in patients with Burkitt lymphoma: An analysis from the Surveillance, Epidemiology, and End Results database Bacteria activate sensory neurons that modulate pain and inflammation Efficient genome engineering in human pluripotent stem cells using Cas9 from Neisseria meningitides Muscle cells provide instructions for planarian regeneration T follicular helper cell dynamics in germinal centers Signatures of mutational processes in human cancer Pediatric intestinal failure–associated liver disease is reversed with 6 months of intravenous fish oil The Mll2 branch of the COMPASS family regulates bivalent promoters in mouse embryonic stem cells Polymalic acid nanobioconjugate for simultaneous immunostimulation and inhibition of tumor growth in HER2/neu-positive breast cancer SCHEMA computational design of virus capsid chimeras: calibrating how genome packaging, protection, and transduction correlate with calculated structural disruption Platelet-biased stem cells reside at the apex of the haematopoietic stem-cell hierarchy Induction of intestinal stem cells by R-spondin 1 and Slit2 augments chemoradioprotection Adult c-kitpos cardiac stem cells are necessary and sufficient for functional cardiac regeneration and repair ST2 as a marker for risk of therapy-resistant graft-versus-host disease and death Inactivation of hepatitis B virus replication in cultured cells and in vivo with engineered transcription activator-like effector nucleases Mouse genetics and proteomic analyses demonstrate a critical role for complement in a model of DHRD/ML, an inherited macular degeneration De novo mutations in epileptic encephalopathies Molecular profiling supports the role of epithelial-to-mesenchymal transition (EMT) in ovarian cancer metastasis Paternally expressed genes predominate in the placenta The epidermis comprises autonomous compartments maintained by distinct stem cell populations Onecut1 is essential for horizontal cell genesis and retinal integrity Low CSF concentration of mitochondrial DNA in preclinical Alzheimer's disease Specific elimination of mutant mitochondrial genomes in patient-derived cells by mitoTALENs Teplizumab (anti-CD3 mAb) treatment preserves C-peptide responses in patients with new-onset type 1 diabetes in a randomized controlled trial: Metabolic and immunologic features at baseline identify a subgroup of responders Nano-imprinting lithography of P(VDF–TrFE–CFE) for flexible freestanding MEMS devices Obstructive sleep apnea and increased risk of glaucoma: a population-based matched-cohort study Single-cell optoporation and transfection using femtosecond laser and optical tweezers Rheumatoid arthritis increases the risk of deep vein thrombosis and pulmonary thromboembolism: a nationwide cohort study Low-frequency (<100 kHz), low-intensity (<100 mW/cm2) ultrasound to treat venous ulcers: A human study and in vitro experiments Spatial dynamics of chromosome translocations in living cells Connectomic reconstruction of the inner plexiform layer in the mouse retina Relationship between dry eye symptoms and pain sensitivity Gingivae contain neural-crest- and mesoderm-derived mesenchymal stem cells Epoxyeicosanoids promote organ and tissue regeneration Efficient generation of human iPSCs by a synthetic self-replicative RNA Transforming fusions of FGFR and TACC genes in human glioblastoma The integrated landscape of driver genomic alterations in glioblastoma Localization of magnetic pills Can bioadhesive nanoparticles allow for more effective particle uptake from the small intestine? Oral delivery of proteins by biodegradable nanoparticles Unique insights into the intestinal absorption, transit, and subsequent biodistribution of polymer-derived microspheres Regional localization within the bone marrow influences the functional capacity of human HSCs SIGIRR, a negative regulator of TLR/IL-1R signalling promotes microbiota dependent resistance to colonization by enteric bacterial pathogens Creating a false memory in the hippocampus AID stabilizes stem-cell phenotype by removing epigenetic memory of pluripotency gene Increased sphingosine-1-phosphate improves muscle regeneration in acutely injured mdx mice Combined alloreactive CTL cellular therapy with prodrug activator gene therapy in a model of breast cancer metastatic to the brain A cyclic peptide inhibitor of C-terminal binding protein dimerization links metabolism with mitotic fidelity in breast cancer cells Therapeutic efficacy of AAV1.SERCA2a in monocrotaline-induced pulmonary arterial hypertension 14-step synthesis of (+)-Ingenol from (+)-3-Carene Purged versus non-purged peripheral blood stem-cell transplantation for high-risk neuroblastoma (COG A3973): a randomised phase 3 trial Adolescent behavior and dopamine availability are uniquely sensitive to dietary omega-3 fatty acid deficiency The DREAM complex mediates GIST cell quiescence and is a novel therapeutic target to enhance Imatinib-induced apoptosis Motile axonal mitochondria contribute to the variability of presynaptic strength Green biosynthesis of gold nanometre scale plates using the leaf extracts from an indigenous Australian plant Eucalyptus macrocarpa The conditional nature of genetic interactions: the consequences of wild-type backgrounds on mutational interactions in a genome-wide modifier screen Acute myeloid leukemia does not deplete normal hematopoietic stem cells but induces cytopenias by impeding their differentiation Repopulation of decellularized mouse heart with human induced pluripotent stem cell-derived cardiovascular progenitor cells Extended practice of a motor skill is associated with reduced metabolic activity in M1 Modeling the photoinduced reconfiguration and directed motion of polymer gels hESC-derived Olig2+ progenitors generate a subtype of astroglia with protective effects against ischaemic brain injury Alzheimer’s disease mutations in APP but not γ-secretase modulators affect epsilon-cleavage-dependent AICD production Temporomandibular joint pain: A critical role for Trpv4 in the trigeminal ganglion Patient-derived induced pluripotent stem cells recapitulate hematopoietic abnormalities of juvenile myelomonocytic leukemia Ribosomal and hematopoietic defects in induced pluripotent stem cells derived from Diamond Blackfan anemia patients Single molecular hyperbranched nanoprobes for fluorescence and magnetic resonance dual modal imaging Correction of diabetic hyperglycemia and amelioration of metabolic anomalies by minicircle DNA mediated glucose-dependent hepatic insulin production Interkinetic nuclear migration is a broadly conserved feature of cell division in pseudostratified epithelia Epithelial junctions maintain tissue architecture by directing planar spindle orientation Activated carbon cloth as support for mesenchymal stem cell growth and differentiation to osteocytes Human umbilical cord stromal stem cell express CD10 and exert contractile properties The importance of bystander effects in radiation therapy in melanoma skin-cancer cells and umbilical-cord stromal stem cells Growth and spontaneous differentiation of umbilical-cord stromal stem cells on activated carbon cloth Self-organized vascular networks from human pluripotent stem cells in a synthetic matrix Epigenetic changes induced by adenosine augmentation therapy prevent epileptogenesis Label-free detection of single protein using a nanoplasmonic-photonic hybrid microcavity Optical control of mammalian endogenous transcription and epigenetic states Dravet syndrome patient-derived neurons suggest a novel epilepsy mechanism Premature cell senescence and T cell receptor–independent activation of CD8+ T cells in juvenile idiopathic arthritis Reactivating head regrowth in a regeneration-deficient planarian species Transcription factor EBF1 is essential for the maintenance of B cell identity and prevention of alternative fates in committed cells Myeloid/microglial driven autologous hematopoietic stem cell gene therapy corrects a neuronopathic lysosomal disease TGFβ receptor mutations impose a strong predisposition for human allergic disease Gingivae contain neural-crest- and mesoderm-derived mesenchymal stem cells Generation of functionally competent and durable engineered blood vessels from human induced pluripotent stem cells Zeb1 regulates E-cadherin and Epcam (epithelial cell adhesion molecule) expression to control cell behavior in early zebrafish development Photoreceptor precursors derived from three-dimensional embryonic stem cell cultures integrate and mature within adult degenerate retina Integrative genomics identifies APOE ε4 effectors in Alzheimer's disease Overcoming preexisting humoral immunity to AAV using capsid decoys The antagonistic modulation of Arp2/3 activity by N-WASP/WAVE2 and PICK1 defines dynamic changes in astrocyte morphology Special section guest editorial: optical methods of imaging in the skin Translating dosage compensation to trisomy 21 Wnt/β-catenin signaling triggers neuron reprogramming and regeneration in the mouse retina LRG1 promotes angiogenesis by modulating endothelial TGF-β signaling Molecular crowding shapes gene expression in synthetic cellular nanosystems Prospective randomized clinical evaluation of conventional single-bundle, anatomic single-bundle, and anatomic double-bundle anterior cruciate ligament reconstruction: 281 cases with 3- to 5-year follow-up Transient B cell depletion combined with apoptotic donor splenocytes induces xeno-specific T and B cell tolerance to islet xenografts Nanoengineering gold particle composite fibers for cardiac tissue engineering TCR-ligand koff rate correlates with the protective capacity of antigen-specific CD8+ T cells for adoptive transfer Noncanonical autophagy promotes the visual cycle Disturbed sleep and inflammatory cytokines in depressed and nondepressed pregnant women: an exploratory analysis of pregnancy outcomes Systemic delivery of SapC-DOPS has antiangiogenic and antitumor effects against glioblastoma Lentiviral hematopoietic stem cell gene therapy benefits Metachromatic Leukodystrophy Lentiviral hematopoietic stem cell gene therapy in patients with Wiskott-Aldrich Syndrome Passive joint forces are tuned to limb use in insects and drive movements without motor activity SLC26A4 targeted to the endolymphatic sac rescues hearing and balance in Slc26a4 mutant mice Heart grafts tolerized through third-party multipotent adult progenitor cells can be retransplanted to secondary hosts with no immunosuppression Magnetic targeting of human mesenchymal stem cells with internalized superparamagnetic iron oxide nanoparticles Positive feedback between PU.1 and the cell cycle controls myeloid differentiation Loss of function of the melanocortin 2 receptor accessory protein 2 is associated with mammalian obesity Insulin and IGF1 modulate turnover of polysialylated neuronal cell adhesion molecule (PSA-NCAM) in a process involving specific extracellular matrix components Reprogramming to pluripotency using designer TALE transcription factors targeting enhancers Iron administration before stem cell harvest enables MR imaging tracking after transplantation DNA computation in mammalian cells: microRNA logic operations In vivo cardiac reprogramming contributes to zebrafish heart regeneration Tunable touch sensor and combined sensing platform: toward nanoparticle-based electronic skin A microparticle approach to morphogen delivery within pluripotent stem cell aggregates Cell-based therapy for ischemic stroke Engineered neural tissue for peripheral nerve repair Translation-dependent displacement of UPF1 from coding sequences causes its enrichment in 3′ UTRs eIF4E-bound mRNPs are substrates for nonsense-mediated mRNA decay in mammalian cells Lentiviral hematopoietic stem cell gene therapy in patients with Wiskott-Aldrich Syndrome Reversal of succinylcholine induced apnea with an organophosphate scavenging recombinant butyrylcholinesterase Chemical communication of antibiotic resistance by a highly resistant subpopulation of bacterial cells MBNL proteins repress ES-cell-specific alternative splicing and reprogramming Global epigenomic reconfiguration during mammalian brain development Lipidomic profiling of influenza infection identifies mediators that induce and resolve inflammation Human placental trophoblasts confer viral resistance to recipient cells Monitoring drug target engagement in cells and tissues using the cellular thermal shift assay Aspirin exposure reveals novel genes associated with platelet function and cardiovascular events 5S ribosomal RNA is an essential component of a nascent ribosomal precursor complex that regulates the Hdm2-p53 checkpoint Reduced incidence of Prevotella and other fermenters in intestinal microflora of autistic children Switchable telescopic contact lens β-globin gene transfer to human bone marrow for sickle cell disease Whole body correction of mucopolysaccharidosis IIIA by intracerebrospinal fluid gene therapy Transplantation of autologous olfactory ensheathing cells in complete human spinal cord injury A comprehensive assessment of gait accelerometry signals in time, frequency and time-frequency domains In vitro integration of ribosomal RNA synthesis, ribosome assembly, and translation Influence of surface features on the adhesion of Staphyloccocus epidermidis to Ag–TiCN thin films Neurons within the same network independently achieve conserved output by differentially balancing variable conductance magnitudes The relationship between diabetic retinopathy and cognitive impairment Efficacy and safety of autologous bone marrow derived stem cell transplantation in patients with type 2 diabetes mellitus: a randomized placebo-controlled study Rapid detection of bacterial resistance to antibiotics using AFM cantilevers as nanomechanical sensors Regulatory dendritic cell infusion prolongs kidney allograft survival in nonhuman primates Wnt activation in nail epithelium couples nail growth to digit regeneration Gold nanorod vaccine for respiratory syncytial virus Dapper antagonist of Catenin-1 cooperates with Dishevelled-1 during postsynaptic development in mouse forebrain Sustained mobilization of endogenous neural progenitors delays disease progression in a transgenic model of Huntingtons Disease Cardiovascular effects of intensive lifestyle intervention in type 2 diabetes An iPSC line from human pancreatic ductal adenocarcinoma undergoes early to invasive stages of pancreatic cancer progression Identification of Drosophila type II neuroblast lineages containing transit amplifying ganglion mother cells Combinatorial temporal patterning in progenitors expands neural diversity A largely random AAV integration profile after LPLD gene therapy Scalable nano-bioprobes with sub-cellular resolution for cell detection MEK inhibitors selectively suppress alloreactivity and graft-versus-host disease in a memory stage-dependent manner iPSC-derived β cells model diabetes due to glucokinase deficiency Hydrogels that mimic developmentally relevant matrix and N-cadherin interactions enhance MSC chondrogenesis Role of reduced-intensity conditioning allogeneic hematopoietic stem-cell transplantation in older patients with de novo myelodysplastic syndromes: an international collaborative decision analysis Self-organization of bacterial biofilms is facilitated by extracellular DNA Intravital FLIM-FRET imaging reveals dasatinibinduced spatial control of Src in pancreatic cancer Awakened by cellular stress: isolation and characterization of a novel population of pluripotent stem cells derived from human adipose tissue Pericytes derived from adipose-derived stem cells protect against retinal vasculopathy In vivo–directed evolution of a new adeno-associated virus for therapeutic outer retinal gene delivery from the vitreous Antigen-specific tolerance by autologous myelin peptide–coupled cells: a phase 1 trial in multiple sclerosis Posttranscriptional control of T cell effector function by aerobic glycolysis Astroglial cells regulate the developmental timeline of human neurons differentiated from induced pluripotent stem cells Fgf9 from dermal γδ T cells induces hair follicle neogenesis after wounding KDR identifies a conserved human and murine hepatic progenitor and instructs early liver development InVERT molding for scalable control of tissue microarchitecture Geometric control of vascular networks to enhance engineered tissue integration and function Identification of small molecules for human hepatocyte expansion and iPS differentiation Mediation of protection and recovery from experimental autoimmune encephalomyelitis by macrophages expressing the human voltage-gated sodium channel NaV1.5 Intranasal antibody gene transfer in mice and ferrets elicits broad protection against pandemic influenza Hypothermic storage of human hepatocytes for transplantation Stepwise evolution of essential centromere function in a Drosophila neogene Phase I/II trial of adeno-associated virus–mediated alpha-glucosidase gene therapy to the diaphragm for chronic respiratory failure in pompe disease: initial safety and ventilatory outcomes Targeting of the MNK–eIF4E axis in blast crisis chronic myeloid leukemia inhibits leukemia stem cell function The perivascular niche regulates breast tumour dormancy Identification of unsafe human induced pluripotent stem cell lines using a robust surrogate assay for pluripotency WNT3 is a biomarker capable of predicting the definitive endoderm differentiation potential of hESCs 11β-hydroxysteroid dehydrogenase blockade prevents age-induced skin structure and function defects Amelioration of motor/sensory dysfunction and spasticity in a rat model of acute lumbar spinal cord injury by human neural stem cell transplantation A preclinical xenograft model identifies castration-tolerant cancer-repopulating cells in localized prostate tumors Recovery from overt type 1 diabetes ensues when immune tolerance and β cell formation are coupled with regeneration of endothelial cells in the pancreatic islets Synergistic effects of GDNF and VEGF on lifespan and disease progression in a familial ALS rat model Allosteric opening of the polypeptide-binding site when an Hsp70 binds ATP High-performance, transparent, and stretchable electrodes using graphene–metal nanowire hybrid structures Significant improvement in survival after allogeneic hematopoietic cell transplantation during a period of significantly increased use, older recipient age, and use of unrelated donors CD4+CD73+ T cells are associated with lower T-cell activation and C reactive protein levels and are depleted in HIV-1 infection regardless of viral suppression Pathogenic plasticity of Kv7.2/3 channel activity is essential for the induction of tinnitus Nanoclays mediate stem cell differentiation and mineralized ECM formation on biopolymer scaffolds Mature HIV-1 capsid structure by cryo-electron microscopy and all-atom molecular dynamics An RNA aptamer provides a novel approach for the induction of apoptosis by targeting the HPV16 E7 oncoprotein The role of gene therapy in regenerative surgery: updated insights Estrogen reduces lipid content in the liver exclusively from membrane receptor signaling Discarded human kidneys as a source of ECM scaffold for kidney regeneration technologies Targeting immunosuppression for cancer therapy Depleting tumor-specific Tregs at a single site eradicates disseminated tumors Risk of cancer among workers exposed to trichloroethylene: analysis of three nordic cohort studies First autologous cell therapy of cerebral palsy caused by hypoxic-ischemic brain damage in a child after cardiac arrest—individual treatment with cord blood Percutaneous tibial nerve stimulation for the long-term treatment of overactive bladder: 3-year results of the STEP study Structural basis of actin filament nucleation by tandem W domains Ectopic activation of germline and placental genes identifies aggressive metastasis-prone lung cancers Adipose tissue-derived multipotent stromal cells have a higher immunomodulatory capacity than their bone marrow-derived counterparts Zwitterionic hydrogels implanted in mice resist the foreign-body reaction Matrix metalloproteinase-8 (collagenase-2) induces the expression of interleukins-6 and -8 in breast cancer cells Bioresorbable airway splint created with a three-dimensional printer Defining single molecular forces required to activate integrin and Notch signaling Identification of candidate genes encoding an LDL-C QTL in baboons Mutations in PDGFRB cause autosomal-dominant infantile myofibromatosis Coordinate transcriptional and translational repression of p53 by TGF-β1 impairs the stress response Do findings on routine examination identify patients at risk for primary open-angle glaucoma? Comment on “ApoE-directed therapeutics rapidly clear β-amyloid and reverse deficits in AD mouse models” Macropinocytosis of protein is an amino acid supply route in Ras-transformed cells Distinct pathways mediate axon degeneration during apoptosis and axon-specific pruning A molecular roadmap of reprogramming somatic cells into iPS cells Delivery of therapeutic agents by nanoparticles made of grapefruit-derived lipids Generation of engraftable hematopoietic stem cells from induced pluripotent stem cells by way of teratoma formation VEGF induces TGF-β1 expression and myofibroblast transformation after glaucoma surgery SMRT compounds abrogate cellular phenotypes of ataxia telangiectasia in neural derivatives of patient-specific hiPSCs Hybrid equation/agent-based model of ischemia-induced hyperemia and pressure ulcer formation predicts greater propensity to ulcerate in subjects with spinal cord injury Epigenomic analysis of multilineage differentiation of human embryonic stem cells Young at heart Growth differentiation factor 11 is a circulating factor that reverses age-related cardiac hypertrophy Amyloid imaging and CSF biomarkers in predicting cognitive impairment up to 7.5 years later Agent Orange as a risk factor for high-grade prostate cancer Generation of functional thymic epithelium from human embryonic stem cells that supports host T cell development Prefrontal microcircuit underlies contextual learning after hippocampal loss Tissue-engineered cardiac patch for advanced functional maturation of human ESC-derived cardiomyocytes Targeting isoprenylcysteine methylation ameliorates disease in a mouse model of progeria Human embryonic stem cells derived by somatic cell nuclear transfer Novel adenoviral vector induces T-cell responses despite anti-adenoviral neutralizing antibodies in colorectal cancer patients Three-dimensional hydrogel constructs for exposing cells to nanoparticles Transient photoreceptor deconstruction by CNTF enhances rAAV-mediated cone functional rescue in late stage CNGB3-achromatopsia Cognate antigen directs CD8+ T cell migration to vascularized transplants Oligodendrocyte progenitors balance growth with self-repulsion to achieve homeostasis in the adult brain Engineering bone tissue substitutes from human induced pluripotent stem cells Linear mesostructures in DNA–nanorod self-assembly Multicenter study of banked third party virus-specific T-cells to treat severe viral infections after hematopoietic stem cell transplantation Nonmelanoma skin cancer is associated with reduced Alzheimer disease risk Chromosome-specific nonrandom sister chromatid segregation during stem-cell division Prospective evaluation of a molecular marker panel for prediction of recurrence and cancer-specific survival after radical cystectomy SMRT compounds abrogate cellular phenotypes of ataxia telangiectasia in neural derivatives of patient-specific hiPSCs Parkin overexpression during aging reduces proteotoxicity, alters mitochondrial dynamics, and extends lifespan Epigenetic activation of AP1 promotes squamous cell carcinoma metastasis Psl trails guide exploration and microcolony formation in Pseudomonas aeruginosa biofilms Role of pericytes in skeletal muscle regeneration and fat accumulation Long-term effects of vitamins C and E, β-carotene, and zinc on age-related macular degeneration: AREDS report no. 35 Lutein/Zeaxanthin for the treatment of age-related cataract: AREDS2 randomized trial report no. 4 Lutein + zeaxanthin and omega-3 fatty acids for age-related macular degeneration: the Age-Related Eye Disease Study 2 (AREDS2) randomized clinical trial Highly elastic micropatterned hydrogel for engineering functional cardiac tissue Evidence for a common mechanism of SIRT1 regulation by allosteric activators A role for PVRL4-driven cell–cell interactions in tumorigenesis Functional maturation of hPSC-derived forebrain interneurons requires an extended timeline and mimics human neural development GABA progenitors grafted into the adult epileptic brain control seizures and abnormal behavior Liver preservation with machine perfusion under full oxygenation using a new cell-free oxygen-carrier solution Reduced Oct4 expression directs a robust pluripotent state with distinct signaling activity and increased enhancer occupancy by Oct4 and Nanog Roles of adipocytes and fibroblasts in activation of the alternative pathway of complement in inflammatory arthritis in mice 3D printed bionic ears Chitosan/poly(vinyl alcohol) hydrogel combined with Ad-hTGF-β1 transfected mesenchymal stem cells to repair rabbit articular cartilage defects Generation of integration-free and region-specific neural progenitors from primate fibroblasts Serine proteolytic pathway activation reveals an expanded ensemble of wound response genes in Drosophila The dual role of mesenchymal stem cells in tumor progression The dual effect of mscs on tumour growth and tumour angiogenesis MicroRNA-382 expression is elevated in the olfactory neuroepithelium of schizophrenia patients Symptom severity predicts prolonged recovery after sport-related concussion, but age and amnesia do not Integrated systems approach identifies genetic nodes and networks in late-onset Alzheimers disease Recruitment of mesenchymal stem cells into prostate tumours promotes metastasis Screening of biochemical and molecular mechanisms of secondary injury and repair in the brain after experimental blast-induced traumatic brain injury in rats Bone marrow tinctures for cardiovascular disease: lost in translation Intracoronary injection of bone marrow derived mononuclear cells, early or late after acute myocardial infarction: effects on global left ventricular function four months results of the SWISS-AMI trial Endothelial TLR4 activation impairs intestinal microcirculatory perfusion in necrotizing enterocolitis via eNOS–NO–nitrite signaling Late-life depression and risk of vascular dementia and Alzheimer’s disease: systematic review and meta-analysis of community-based cohort studies Generation of oligodendroglial cells by direct lineage conversion Melatonin inhibits the caspase-1/cytochrome c/caspase-3 cell death pathway, inhibits MT1 receptor loss and delays disease progression in a mouse model of amyotrophic lateral sclerosis Self-assembled, aptamer-tethered DNA nanotrains for targeted transport of molecular drugs in cancer Effect of shock wave–facilitated intracoronary cell therapy on LVEF in patients with chronic heart failure Regulation of stem cell therapies under attack in Europe: for whom the bell tolls A physical sciences network characterization of non-tumorigenic and metastatic cells A systematic genome-wide analysis of zebrafish protein-coding gene function Medial ganglionic eminence–like cells derived from human embryonic stem cells correct learning and memory deficits Type 2 innate signals stimulate fibro/adipogenic progenitors to facilitate muscle regeneration Transcription factor–mediated reprogramming of fibroblasts to expandable, myelinogenic oligodendrocyte progenitor cells Regeneration and experimental orthotopic transplantation of a bioengineered kidney Intranasal delivery of pGDNF nanoparticles provides neuroprotection in the rat 6-hydroxydopamine model of Parkinson’s disease Thrombospondin-1 signaling through CD47 inhibits self-renewal by regulating c-Myc and other stem cell transcription factors Lower baseline prostate-specific antigen is associated with a greater overall survival benefit from sipuleucel-T in the Immunotherapy for Prostate Adenocarcinoma Treatment (IMPACT) trial Identification of a population of blood circulating tumor cells from breast cancer patients that initiates metastasis in a xenograft assay Transcription factor–mediated reprogramming of fibroblasts to expandable, myelinogenic oligodendrocyte progenitor cells Cardiopoietic stem cell therapy in heart failure The C-CURE multicenter randomized trial with lineage-specified biologics Impaired cholesterol efflux in senescent macrophages promotes age-related macular degeneration Implantation of bone marrow-derived mesenchymal stem cells demonstrates improved outcome in horses with overstrain injury of the superficial digital flexor tendon Concentrated bone marrow aspirate improves full-thickness cartilage repair compared with microfracture in the equine model Effect of adipose-derived mesenchymal stem and regenerative cells on lameness in dogs with chronic osteoarthritis of the coxofemoral joints: a randomized, double-blinded, multicenter, controlled trial CD24 and CD44 mark human intestinal epithelial cell populations with characteristics of active and facultative stem cells Rigid microenvironments promote cardiac differentiation of mouse and human embryonic stem cells Micromanaging hepatitis C virus Treatment of HCV infection by targeting microRNA Amplifying genetic logic gates Rational design of a ligand-controlled protein conformational switch Optically triggering spatiotemporally confined GPCR activity in a cell and programming neurite initiation and extension Optical control demonstrates switch-like PIP3 dynamics underlying the initiation of immune cell migration Tissue engineering and regenerative medicine: recent innovations and the transition to translation Reducing TMPRSS6 ameliorates hemochromatosis and β-thalassemia in mice Macrophages support pathological erythropoiesis in polycythemia vera and β-thalassemia A combinatorial F box protein directed pathway controls TRAF adaptor stability to regulate inflammation An antisense oligonucleotide against SOD1 delivered intrathecally for patients with SOD1 familial amyotrophic lateral sclerosis: a phase 1, randomised, first-in-man study Degradation-mediated cellular traction directs stem cell fate in covalently crosslinked three-dimensional hydrogels Autophagy in stem cells FIP200 is required for maintenance and differentiation of postnatal neural stem cells Mesenchymal stem cells engineered to inhibit complement-mediated damage Stromal cell identity influences the in vivo functionality of engineered capillary networks formed by co-delivery of endothelial cells and stromal cells Cellular and molecular basis of von Willebrand disease: studies on blood outgrowth endothelial cells Klf5 controls bone marrow homing of stem cells and progenitors through Rab5-mediated β1/β2-integrin trafficking Intracellular aggregation of multimodal silica nanoparticles for ultrasound-guided stem cell implantation Improved methods for reprogramming human dermal fibroblasts using fluorescence activated cell sorting The circadian clock gates the intestinal stem cell regenerative state Adhesion strength–based, label-free isolation of human pluripotent stem cells Drug screening using a library of human induced pluripotent stem cell-derived cardiomyocytes reveals disease specific patterns of cardiotoxicity Keratocyte fragments and cells utilize competing pathways to move in opposite directions in an electric field Assembly of complex cell microenvironments using geometrically docked hydrogel shapes Chimeric antigen receptor T cells with dissociated signaling domains exhibit focused antitumor activity with reduced potential for toxicity in vivo Laparoscopic pyeloplasty for ureteropelvic junction obstruction in infants Cell-based therapeutics: the next pillar of medicine CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia Regulation of stem cell fate in a three-dimensional micropatterned dual-crosslinked hydrogel system A tissue-like printed material Improved ex vivo expansion of adult hematopoietic stem cells by overcoming CUL4-mediated degradation of HOXB4 Transgenic overexpression of ribonucleotide reductase improves cardiac performance The human placenta methylome Targeting chronic lymphocytic leukemia cells with a humanized monoclonal antibody specific for CD44 Mouse urinary peptides provide a molecular basis for genotype discrimination by nasal sensory neurons Survey of the human pancreatic beta-cell G1/S proteome reveals a potential therapeutic role for cdk-6 and cyclin D1 in enhancing human beta-cell replication and function in vivo A human pancreatic beta cell G1/S molecule cell cycle atlas Cytoplasmic-nuclear trafficking of G1/S cell cycle molecules and adult human beta cell replication: a revised model of human beta cell G1/S control An epigenetic component of hematopoietic stem cell aging amenable to reprogramming into a young state Generation of induced neurons via direct conversion in vivo Self-deployable current sources fabricated from edible materials Inflammatory bowel disease Nonxenogeneic growth and retinal differentiation of human induced pluripotent stem cells A localized Wnt signal orients asymmetric stem cell division in vitro Disparate individual fates compose robust CD8+ T cell immunity A molecular basis for the control of preimmune escape variants by HIV-specific CD8+ T cells Multifunctional T-cell analyses to study response and progression in adoptive cell transfer immunotherapy Four-part leukocyte differential count based on sheathless microflow cytometer and fluorescent dye assay Genes for endosomal NHE6 and NHE9 are misregulated in autism brains Induced pluripotent stem cell-derived neural cells survive and mature in the nonhuman primate brain Temperature sculpting in yoctoliter volumes Mini-chromosome maintenance complexes form a filament to remodel DNA structure and topology Secondary T cell–T cell synaptic interactions drive the differentiation of protective CD8+ T cells Cytolytic nanoparticles attenuate HIV-1 infectivity Targeting the intracellular WT1 oncogene product with a therapeutic human antibody The human gene connectome as a map of short cuts for morbid allele discovery Novel higher-order epigenetic regulation of the Bdnf gene upon seizures EBF2 determines and maintains brown adipocyte identity Synaptic plasticity by antidromic firing during hippocampal network oscillations Hyaluronic acid based self-assembling nanosystems for CD44 target mediated siRNA delivery to solid tumors Rab11 regulates cell–cell communication during collective cell movements Local potentiation of excitatory synapses by serotonin and its alteration in rodent models of depression Tumor VEGF:VEGFR2 autocrine feed-forward loop triggers angiogenesis in lung cancer Oncogenic BRAF regulates oxidative metabolism via PGC1α and MITF Mesenchymal stem cells derived from adipose tissue vs bone marrow: in vitro comparison of their tropism towards gliomas Stromal cell-derived factor-1β mediates cell survival through enhancing autophagy in bone marrow-derived mesenchymal stem cells A KRAB/KAP1-miRNA cascade regulates erythropoiesis through stage-specific control of mitophagy Genome-wide study of association and interaction with maternal cytomegalovirus infection suggests new schizophrenia loci Outcomes of transplantation using various hematopoietic cell sources in children with Hurler's syndrome after myeloablative conditioning Mechanism of transport of saquinavir-loaded nanostructured lipid carriers across the intestinal barrier Dextran and protamine-based solid lipid nanoparticles as potential vectors for the treatment of X-linked juvenile retinoschisis Interplay of LRRK2 with chaperone-mediated autophagy Combination treatment of stroke with sub-therapeutic doses of Simvastatin and human umbilical cord blood cells enhances vascular remodeling and improves functional outcome Improvement in poor graft function after allogeneic hematopoietic stem cell transplantation upon administration of mesenchymal stem cells from third-party donors: a pilot prospective study Autologous bone marrow-derived cell therapy combined with physical therapy induces functional improvement in chronic spinal cord injury patients Bench to bedside review: Extracorporeal carbon dioxide removal, past present and future ‘See-saw’ expression of microRNA-198 and FSTL1 from a single transcript in wound healing Topical administration of allogeneic mesenchymal stem cells seeded in a collagen scaffold augments wound healing and increases angiogenesis in the diabetic rabbit ulcer Complement factor H variant increases the risk of age-related macular degeneration Seven new loci associated with age-related macular degeneration Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration Relationship of age and body mass index to the expression of obesity and osteoarthritis-related genes in human meniscus Lipid metabolism genes in contralateral unaffected breast and estrogen receptor status of breast cancer Actin depolymerization under force is governed by lysine 113:glutamic acid 195-mediated catch-slip bonds Cell-free protein synthesis and assembly on a biochip Forebrain engraftment by human glial progenitor cells enhances synaptic plasticity and learning in adult mice Independent category and spatial encoding in parietal cortex Sodium chloride drives autoimmune disease by the induction of pathogenic TH17 cells Induction of pathogenic TH17 cells by inducible salt-sensing kinase SGK1 Dynamic regulatory network controlling TH17 cell differentiation An ex vivo gene therapy approach to treat muscular dystrophy using inducible pluripotent stem cells Class II major histocompatibility complex plays an essential role in obesity-induced adipose inflammation MCM proteins are negative regulators of hypoxia-inducible factor 1 Analysis of national and single-center incidence and survival after liver transplantation for hepatoblastoma: New trends and future opportunities Transferred WT1-reactive CD8+ T cells can mediate antileukemic activity and persist in post-transplant patients RNAi–based functional profiling of loci from blood lipid genome-wide association studies identifies genes with cholesterol-regulatory function Mutations in prion-like domains in hnRNPA2B1 and hnRNPA1 cause multisystem proteinopathy and ALS Loss of FBP1 by Snail-mediated repression provides metabolic advantages in basal-like breast cancer Jmjd3 inhibits reprogramming by upregulating expression of INK4a/Arf and targeting PHF20 for ubiquitination Seven new loci associated with age-related macular degeneration Biofilm streamers cause catastrophic disruption of flow with consequences for environmental and medical systems Development, characterization, and use of a porcine epiblast-derived liver stem cell line: ARS-PICM-19 Distinct contribution of human cord blood-derived endothelial colony forming cells to liver and gut in a fetal sheep model EphB2 isolates a human marrow stromal cell subpopulation with enhanced ability to contribute to the resident intestinal cellular pool High-fidelity tissue engineering of patient-specific auricles for reconstruction of pediatric microtia and other auricular deformities Virgin birth: engineered heart muscle from parthenogenetic stem cells Parthenogenetic stem cells for tissue-engineered heart repair A nontranscriptional role for HIF-1α as a direct inhibitor of DNA replication Cystoid macular edema in retinitis pigmentosa patients without associated macular thickening Acanthamoeba keratitis associated with tap water use during contact lens cleaning: manufacturer guidelines need to change Three-dimensional spectral-domain optical coherence tomography data analysis for glaucoma detection Immobilization of heparan sulfate on electrospun meshes to support embryonic stem cell culture and differentiation Sequencing of the sea lamprey (Petromyzon marinus) genome provides insights into vertebrate evolution Identification of stem cells in small intestine and colon by marker gene Lgr5 In vitro expansion of single Lgr5+ liver stem cells induced by Wnt-driven regeneration Epigenomic plasticity enables human pancreatic α to β cell reprogramming Safety and efficacy of an injectable extracellular matrix hydrogel for treating myocardial infarction Brain cells for grandmother A pseudogene long-noncoding-RNA network regulates PTEN transcription and translation in human cells Tympanic border cells are Wnt-responsive and can act as progenitors for postnatal mouse cochlear cells An open-label dose escalation study to evaluate the safety of administration of nonviral stromal cell-derived factor-1 plasmid to treat symptomatic ischemic heart failure Polymer nanofiber-embedded microchips for detection, isolation, and molecular analysis of single circulating melanoma cells Haematopoietic stem cells and early lymphoid progenitors occupy distinct bone marrow niches CXCL12 in early mesenchymal progenitors is required for haematopoietic stem-cell maintenance Discovery and evaluation of a functional ternary polymer blend for bone repair: translation from a microarray to a clinical model Enhancing chemotherapy response with sustained EphA2 silencing using multistage vector delivery NANOG-dependent function of TET1 and TET2 in establishment of pluripotency Treatment of diabetes and long-term survival following insulin and glucokinase gene therapy Neural progenitors derived from human induced pluripotent stem cells survive and differentiate upon transplantation into a rat model of amyotrophic lateral sclerosis C-reactive protein and the incidence of macular degeneration—pooled analysis of 5 cohorts A cis-acting element in retroviral genomic RNA links Gag-Pol ribosomal frameshifting to selective viral RNA encapsidation Identification of genetic susceptibility loci for colorectal tumors in a genome-wide meta-analysis Regenerative biotechnological treatment Nanowire-based electrode for acute in vivo neural recordings in the brain Subretinal electronic chips allow blind patients to read letters and combine them to words Artificial vision with wirelessly powered subretinal electronic implant alpha-IMS FMRP regulates neurotransmitter release and synaptic information transmission by modulating action potential duration via BK channels The epithelial-mesenchymal transition generates cells with properties of stem cells FOXC2 expression links epithelial-mesenchymal transition and stem cell properties in breast cancer FOXO3A directs a protective autophagy program in haematopoietic stem cells A heparin-mimicking polymer conjugate stabilizes basic fibroblast growth factor Long noncoding RNAs with enhancer-like function in human cells Activating RNAs associate with Mediator to enhance chromatin architecture and transcription Perivascular mesenchymal progenitors in human fetal and adult liver Fbxl10/Kdm2b recruits polycomb repressive complex 1 to CpG islands and regulates H2A ubiquitylation Astrocyte pathology and the absence of non-cell autonomy in an induced pluripotent stem cell model of TDP-43 proteinopathy Expression profiling of mouse subplate reveals a dynamic gene network and disease association with autism and schizophrenia Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia Transferring a synthetic gene circuit from yeast to mammalian cells Synthetic circuits integrating logic and memory in living cells Tcf15 primes pluripotent cells for differentiation Cotransplantation with specific populations of spina bifida bone marrow stem/progenitor cells enhances urinary bladder regeneration Mixed modeling of meta-analysis p-values (MixMAP) suggests multiple novel gene loci for low density lipoprotein cholesterol Cellular complexity captured in durable silica biocomposites Inhibition of JNK mitochondrial localization and signaling is protective against ischemia/reperfusion injury in rats Degradable polymeric nanocapsule for efficient intracellular delivery of a high molecular weight tumor-selective protein complex Extracting intracellular diffusive states and transition rates from single-molecule tracking data Calmodulin mutations associated with recurrent cardiac arrest in infants Long noncoding RNAs regulate adipogenesis Mitochondrial hyperfusion induced by loss of the fission protein Drp1 causes ATM-dependent G2/M arrest and aneuploidy through DNA replication stress Evolutionary rate covariation in meiotic proteins results from fluctuating evolutionary pressure in yeasts and mammals Ras oncoproteins transfer from melanoma cells to T Cells and modulate their effector functions Lgr5-EGFP marks taste bud stem/progenitor cells in posterior tongue Transplanted progenitors generate functional enteric neurons in the postnatal colon Targeting CXCR1/2 significantly reduces breast cancer stem cell activity and increases the efficacy of inhibiting HER2 via HER2-dependent and -independent mechanisms Epidermal growth factor regulates hematopoietic regeneration after radiation injury The effect of the composition of PLA films and lactate release on glial and neuronal maturation and the maintenance of the neuronal progenitor niche Acetylation limits 53BP1 association with damaged chromatin to promote homologous recombination Landscape of somatic single-nucleotide and copy-number mutations in uterine serous carcinoma GATA3 suppresses metastasis and modulates the tumour microenvironment by regulating microRNA-29b expression CD271+ bone marrow mesenchymal stem cells may provide a niche for dormant mycobacterium tuberculosis Control of nutrient stress-induced metabolic reprogramming by PKCζ in tumorigenesis Studying arrhythmogenic right ventricular dysplasia with patient-specific iPSCs Mps1 and Ipl1/Aurora B act sequentially to correctly orient chromosomes on the meiotic spindle of budding yeast An electrocorticographic brain interface in an individual with tetraplegia Comparative analysis of circulating endothelial progenitor cells in age-related macular degeneration patients using automated rare cell analysis (ARCA) and fluorescence activated cell sorting (FACS) LBR and Lamin A/C sequentially tether peripheral heterochromatin and inversely regulate differentiation Acidity generated by the tumor microenvironment drives local invasion A role for Schwann cell–derived neuregulin-1 in remyelination Effects of intravenous administration of allogenic bone marrow- and adipose tissue-derived mesenchymal stem cells on functional recovery and brain repair markers in experimental ischemic stroke Neuregulin-1 enhances depolarization-induced GABA release Erbin interacts with TARP γ-2 for surface expression of AMPA receptors in cortical interneurons Genomes of replicatively senescent cells undergo global epigenetic changes leading to gene silencing and activation of transposable elements The potential of apolipoprotein E4 to act as a substrate for primary cultures of hippocampal neurons Immunogenicity of induced pluripotent stem cells Lack of immune response to differentiated cells derived from syngeneic induced pluripotent stem cells Significance analysis of prognostic signatures Schizophrenia: A neurodevelopmental disorder — Integrative genomic hypothesis and therapeutic implications from a transgenic mouse model Quantitative visualization of DNA G-quadruplex structures in human cells Differential effects of grape seed extract against human colorectal cancer cell lines: The intricate role of death receptors and mitochondria Reprogramming adult schwann cells to stem cell-like cells by leprosy bacilli promotes dissemination of infection BRCA1 loss activates cathepsin L–mediated degradation of 53BP1 in breast cancer cells Epigenome-wide association data implicate DNA methylation as an intermediary of genetic risk in rheumatoid arthritis Population dynamics of normal and leukaemia stem cells in the haematopoietic stem cell niche show distinct regimes where leukaemia will be controlled Uracil DNA glycosylase initiates degradation of HIV-1 cDNA containing misincorporated dUTP and prevents viral integration Braveheart, a long noncoding RNA required for cardiovascular lineage commitment Prenatal cerebral ischemia disrupts MRI-defined cortical microstructure through disturbances in neuronal arborization Human retinal gene therapy for Leber congenital amaurosis shows advancing retinal degeneration despite enduring visual improvement RYBP and Cbx7 define specific biological functions of polycomb complexes in mouse embryonic stem cells Generation of an HIV resistant T-cell line by targeted “stacking” of restriction factors Relationship of aspirin use with age-related macular degeneration: association or causation? The association of aspirin use with age-related macular degeneration The 510(k) ancestry of a metal-on-metal hip implant Interstitial dendritic cell guidance by haptotactic chemokine gradients Cardiomyocyte proliferation contributes to heart growth in young humans A thermoresponsive and chemically defined hydrogel for long-term culture of human embryonic stem cells Discovery and validation of cell cycle arrest biomarkers in human acute kidney injury The 2013 International Society for Heart and Lung Transplantation guidelines for mechanical circulatory support: executive summary Injection of vessel-derived stem cells prevents dilated cardiomyopathy and promotes angiogenesis and endogenous cardiac stem cell proliferation in mdx/utrn−/− but not aged mdx mouse models for Duchenne muscular dystrophy Anticancer activity of rice callus suspension culture Microdystrophin ameliorates muscular dystrophy in the canine model of Duchenne muscular dystrophy Mutation of a NCKX eliminates glial microdomain calcium oscillations and enhances seizure susceptibility Transcriptional reprogramming of mature CD4+ helper T cells generates distinct MHC class II–restricted cytotoxic T lymphocytes Sickle erythrocytes target cytotoxics to hypoxic tumor microvessels and potentiate a tumoricidal response Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus Dynamic chromatin remodeling mediated by polycomb proteins orchestrates pancreatic differentiation of human embryonic stem cells Differential regulation of distinct Vps34 complexes by AMPK in nutrient stress and autophagy A pan-BCL2 inhibitor renders bone-marrow-resident human leukemia stem cells sensitive to tyrosine kinase inhibition MHC class I–restricted myelin epitopes are cross-presented by Tip-DCs that promote determinant spreading to CD8+ T cells The impact of Crohn's disease genes on healthy human gut microbiota: a pilot study The cytoplasm of living cells behaves as a poroelastic material Evaluation of the cell viability of human wharton's jelly stem cells for use in cell therapy Abnormal fixation in individuals with age-related macular degeneration when viewing an image of a face Endothelial reconstitution by CD34+ progenitors derived from baboon embryonic stem cells Reversal of end-stage retinal degeneration and restoration of visual function by photoreceptor transplantation MUC1 vaccine for individuals with advanced adenoma of the colon: a cancer immunoprevention feasibility study Retinal vessel caliber is associated with the 10-year incidence of glaucoma In vivo cardiac cellular reprogramming efficacy is enhanced by angiogenic preconditioning of the infarcted myocardium with vascular endothelial growth factor Engineering cell surfaces for orthogonal selectability Sickle erythrocytes target cytotoxics to hypoxic tumor microvessels and potentiate a tumoricidal response Dielectrophoresis based discrimination of human embryonic stem cells from differentiating derivatives CXCR5+ T helper cells mediate protective immunity against tuberculosis Genetic control of obesity and gut microbiota composition in response to high-fat, high-sucrose diet in mice Direct conversion of fibroblasts to neurons by reprogramming PTB-regulated microRNA circuits A subpopulation of nociceptors specifically linked to itch RNA processing enables predictable programming of gene expression A programmable dual-RNA–guided DNA endonuclease in adaptive bacterial immunity Multiplex genome engineering using CRISPR/Cas systems RNA-guided human genome engineering via Cas9 Notch inhibition induces cochlear hair cell regeneration and recovery of hearing after acoustic trauma Exposure to a cutinase-like serine esterase triggers rapid lysis of multiple mycobacterial species Reconfigurable assemblies of active, autochemotactic gels Comparison of proliferative capacity of genetically-engineered pig and human corneal endothelial cells Klf4 regulates the expression of slurp1, which functions as an immunomodulatory Peptide in the mouse cornea High dynamic range (HDR) imaging concept based signal enhancement method reduced the optical coherence tomography (OCT) measurement variability Detection of glaucoma progression by population and individual derived variability criteria Regeneration of human tumor antigen-specific T cells from iPSCs derived from mature CD8+ T cells Generation of rejuvenated antigen-specific T cells by reprogramming to pluripotency and redifferentiation Maternal serum 25-hydroxyvitamin d and measures of newborn and placental weight in a U.S. multicenter cohort study How insulin engages its primary binding site on the insulin receptor Common variants in psychiatric risk genes predict brain structure at birth Functional characterization of piggyBat from the bat Myotis lucifugus unveils an active mammalian DNA transposon Expression of RORγt marks a pathogenic regulatory T cell subset in human colon cancer Refinement in localization and identification of gene regions associated with Crohn Disease Multimodal actions of neural stem cells in a mouse model of ALS: a meta-analysis PDK1 regulation of mTOR and hypoxia-inducible factor 1 integrate metabolism and migration of CD8+ T cells Distribution and compartmentalization of human circulating and tissue-resident memory T cell subsets Spikes in mammalian bipolar cells support temporal layering of the inner retina Reactivation of neural ensembles during the retrieval of recent and remote memory Capture and stimulated release of circulating tumor cells on polymer-grafted silicon nanostructures Long-term safety and efficacy of human-induced pluripotent stem cell (iPS) grafts in a preclinical model of retinitis pigmentosa Gene therapy provides long-term visual function in a pre-clinical model of retinitis pigmentosa Race and ethnicity in decisions about unrelated hematopoietic stem cell donation Differential susceptibility of inbred mouse strains to chlorine-induced airway fibrosis Comorbidity in patients with branch retinal vein occlusion: case-control study Cord-blood engraftment with ex vivo mesenchymal-cell coculture Crosstalk between neutrophils, B-1a cells and plasmacytoid dendritic cells initiates autoimmune diabetes Cell-extrinsic effects of tumor ER stress imprint myeloid dendritic cells and impair CD8+ T cell priming ATP sequestration by a synthetic ATP-binding protein leads to novel phenotypic changes in Escherichia coli Parkin ubiquitinates Tar-DNA binding protein-43 (TDP-43) and promotes its cytosolic accumulation via interaction with histone deacetylase 6 (HDAC6) Circulatory antigen processing by mucosal dendritic cells controls CD8+ T cell activation Dystroglycan organizes axon guidance cue localization and axonal pathfinding Brown adipose tissue regulates glucose homeostasis and insulin sensitivity The isolation and characterization of renal cancer initiating cells from human Wilms' tumour xenografts unveils new therapeutic targets Competing and noncompeting activities of miR-122 and the 5' exonuclease Xrn1 in regulation of hepatitis C virus replication The RNA Pol II elongation factor Ell3 marks enhancers in ES cells and primes future gene activation Direct conversion of quiescent cardiomyocytes to pacemaker cells by expression of Tbx18 Long-term follow-up assessment of a phase 1 trial of angiogenic gene therapy using direct intramyocardial administration of an adenoviral vector expressing the VEGF121 cDNA for the treatment of diffuse coronary artery disease Role of km23-1 in RhoA/actin-based cell migration A novel alternative to cryo-preservation for the short term storage of stem cells for use in cell therapy using alginate encapsulation Long-term follow-up after gene therapy for Canavan disease Multiphoton imaging reveals a new leukocyte recruitment paradigm in the glomerulus Combinatorial antigen recognition with balanced signaling promotes selective tumor eradication by engineered T cells Serine starvation induces stress and p53-dependent metabolic remodelling in cancer cells Derivation and maturation of synthetic and contractile vascular smooth muscle cells from human pluripotent stem cells Nonmuscle myosin IIB links cytoskeleton to IRE1α signaling during ER stress Rapid casting of patterned vascular networks for perfusable engineered three-dimensional tissues Engineering antigens for in situ erythrocyte binding induces T-cell deletion FMRP targets distinct mRNA sequence elements to regulate protein expression Blockade of myeloid-derived suppressor cells after induction of lymphopenia improves adoptive T cell therapy in a murine model of melanoma Human coronavirus EMC does not require the SARS-coronavirus receptor and maintains broad replicative capability in mammalian cell lines Alkylation sensitivity screens reveal a conserved cross-species functionome Nanoroughened surfaces for efficient capture of circulating tumor cells without using capture antibodies Salmonella transforms follicle-associated epithelial cells into M cells to promote intestinal invasion The structural basis of direct glucocorticoid-mediated transrepression Highly conductive carbon nanotube matrix accelerates developmental chloride extrusion in central nervous system neurons by increased expression of chloride transporter KCC2 Cell-specific multifunctional processing of heterogeneous cell systems in a single laser pulse treatment Influence of water on the structure and properties of PDMS-containing multiblock polyurethanes Simple precision creation of digitally specified, spatially heterogeneous, engineered tissue architectures Construction of a global pain systems network highlights phospholipid signaling as a regulator of heat nociception Large-scale screening using familial dysautonomia induced pluripotent stem cells identifies compounds that rescue IKBKAP expression Sustained effector function of IL-12/15/18–preactivated NK cells against established tumors Use of reprogrammed cells to identify therapy for respiratory papillomatosis Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells Metastatic colonization requires the repression of the epithelial-mesenchymal transition inducer Prrx1 Co-Injection of a targeted, reversibly masked endosomolytic polymer dramatically improves the efficacy of cholesterol-conjugated small interfering RNAs in vivo Biasing amacrine subtypes in the Atoh7 lineage through expression of Barhl2 Autologous mesenchymal stem cell–derived dopaminergic neurons function in parkinsonian macaques Creating a bio-hybrid signal transduction pathway: opening a new channel of communication between cells and machines Prostaglandin e2 increases hematopoietic stem cell survival and accelerates hematopoietic recovery after radiation injury MEF promotes stemness in the pathogenesis of gliomas p27Kip1 directly represses Sox2 during embryonic stem cell differentiation Delayed saccadic eye movements in glaucoma Critical microcarrier properties affecting the expansion of undifferentiated human embryonic stem cells Microcarrier suspension cultures for high-density expansion and differentiation of human pluripotent stem cells to neural progenitor cells Aged human cells rejuvenated by cytokine enhancement of biomaterials for surgical ventricular restoration Polycomb PHF19 binds H3K36me3 and recruits PRC2 and demethylase NO66 to embryonic stem cell genes during differentiation Longitudinal outcome of isolated mitral repair in older patients: results from 14,604 procedures performed from 1991 to 2007 A versatile synthetic platform for a wide range of functionalized biomaterials Substantial expression of mature elastin in arterial constructs High-performance neuroprosthetic control by an individual with tetraplegia Intermittent fasting: A “new” historical strategy for controlling seizures? Generation of integration-free neural progenitor cells from cells in human urine Sustained effector function of IL-12/15/18–preactivated NK cells against established tumors Autologous mesenchymal stem cell–derived dopaminergic neurons function in parkinsonian macaques Short-term, long-term and paracrine effect of human umbilical cord-derived stem cells in lung injury prevention and repair in experimental bronchopulmonary dysplasia Prolonged strenuous exercise expands the population of developmentally early stem cells in bone marrow & mobilizes them into peripheral blood - evidence...supports a positive effect of physical activity on extension of life span at the level of stem cells No survival advantage after double umbilical cord blood (UCB) compared to single UCB transplant in children with hematological malignancy: results of the blood and marrow transplant clinical trials network (BMT CTN 0501) randomized trial Targeting histone deacetylases as a new strategy for graft versus host disease prevention Injectable polyethylene glycol-fibrinogen hydrogel adjuvant improves survival and differentiation of transplanted mesoangioblasts in acute and chronic skeletal-muscle degeneration Transposable elements reveal a stem cell specific class of long noncoding RNAs Histone demethylase JMJD2C is a coactivator for hypoxia-inducible factor 1 that is required for breast cancer progression Prevalence and predictors of Sjögren's syndrome in a prospective cohort of patients with aqueous-deficient dry eye Topical simvastatin accelerates wound healing in diabetes by enhancing angiogenesis and lymphangiogenesis Motor recovery after spinal cord injury enhanced by strengthening corticospinal synaptic transmission Intramyocardial injections of human mesenchymal stem cells following acute myocardial infarction modulate scar formation and improve left ventricular function Human induced pluripotent stem cell-derived models to investigate human cytomegalovirus infection in neural cells ER stress–mediated autophagy promotes Myc-dependent transformation and tumor growth Hybrid printing of mechanically and biologically improved constructs for cartilage tissue engineering applications Single-cell-resolution imaging of the impact of notch signaling and mitosis on segmentation clock dynamics Robust photoregulation of GABAA receptors by allosteric modulation with a propofol analogue Epigenetic regulation of olfactory receptor gene expression by the Myb–MuvB/dREAM complex De novo derivation of proteomes from transcriptomes for transcript and protein identification Facilitators and impediments of the pluripotency reprogramming factors' initial engagement with the genome A human disease model of drug toxicity–induced pulmonary edema in a lung-on-a-chip microdevice A novel role for lipid droplets in the organismal antibacterial response Long noncoding RNAs with snoRNA ends Critical variables in the alignment of electrospun PLLA nanofibers Combining topographical and genetic cues to promote neuronal fate specification in stem cells A culture system to study oligodendrocyte myelination processes using engineered nanofibers Vitamin D receptor as a master regulator of the c-MYC/MXD1 network MicroRNAs reprogram normal fibroblasts into cancer-associated fibroblasts in ovarian cancer Characterization and therapeutic potential of induced pluripotent stem cell-derived cardiovascular progenitor cells Planar cell polarity controls pancreatic beta cell differentiation and glucose homeostasis Autologous olfactory mucosal cell transplants in clinical spinal cord injury: a randomized double-blinded trial in a canine translational model Printing and prototyping of tissues and scaffolds Systemic TNFα gene therapy synergizes with liposomal doxorubicine in the treatment of metastatic cancer Use of reprogrammed cells to identify therapy for respiratory papillomatosis Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells Adult pancreas side population cells expand after β cell injury and are a source of insulin-secreting cells High-frequency hippocampal oscillations activated by optogenetic stimulation of transplanted human ESC-derived neurons iPS cell modeling of Best disease: insights into the pathophysiology of an inherited macular degeneration Injectable preformed scaffolds with shape-memory properties In vivo directed differentiation of pluripotent stem cells for skeletal regeneration Continued DNA synthesis in replication checkpoint mutants leads to fork collapse Manipulation of PK-M mutually exclusive alternative splicing by antisense oligonucleotides Phenotypic and functional characterization of the luminal cell hierarchy of the mammary gland Fat grafting’s past, present, and future-why adipose tissue is emerging as a critical link to the advancement of regenerative medicine HIRA dependent H3.3 deposition is required for transcriptional reprogramming following nuclear transfer to Xenopus oocytes Exome sequencing of serous endometrial tumors identifies recurrent somatic mutations in chromatin-remodeling and ubiquitin ligase complex genes Lgr5+ve stem/progenitor cells contribute to nephron formation during kidney development Exosomes mediate the cytoprotective action of mesenchymal stromal cells on hypoxia-induced pulmonary hypertension BMP4 sufficiency to induce choroid plexus epithelial fate from embryonic stem cell-derived neuroepithelial progenitors Attenuation of miR-126 activity expands HSC in vivo without exhaustion Stem cell therapy in equine tendon injury Cartilage tissue engineering using differentiated and purified induced pluripotent stem cells Targeting glioma stem cells by functional inhibition of a prosurvival oncomiR-138 in malignant gliomas A bimodular mechanism of calcium control in eukaryotes The genomic landscape and evolutionary resolution of antagonistic pleiotropy in yeast Common genetic variants in the CLDN2 and PRSS1-PRSS2 loci alter risk for alcohol-related and sporadic pancreatitis Mitochondrial gene replacement in primate offspring and embryonic stem cells Towards germline gene therapy of inherited mitochondrial diseases ECM microenvironment regulates collective migration and local dissemination in normal and malignant mammary epithelium Regulation of pluripotency and self- renewal of ESCs through epigenetic- threshold modulation and mRNA pruning Improved working memory but no effect on striatal vesicular monoamine transporter type 2 after omega-3 polyunsaturated fatty acid supplementation Patterns of scAAV vector insertion associated with oncogenic events in a mouse model for genotoxicity Bone marrow-derived circulating endothelial precursors do not contribute to vascular endothelium and are not needed for tumor growth Generation of functional blood vessels from a single c-kit+ adult vascular endothelial stem cell The ydaO motif is an ATP-sensing riboswitch in Bacillus subtilis Glial progenitor cell–based treatment and modeling of neurological disease N-WASP coordinates the delivery and F-actin–mediated capture of MT1-MMP at invasive pseudopods Efficient direct reprogramming of mature amniotic cells into endothelial cells by ETS factors and TGFβ suppression Circadian Dbp transcription relies on highly dynamic BMAL1-CLOCK interaction with E boxes and requires the proteasome Peripheral-blood stem cells versus bone marrow from unrelated donors Adoptive transfer of cytotoxic T lymphocytes targeting two different antigens limits antigen loss and tumor escape Recognition of glioma stem cells by genetically modified T cells targeting EGFRvIII and development of adoptive cell therapy for glioma Efficacy of adoptive cell transfer of tumor-infiltrating lymphocytes after lymphopenia induction for metastatic melanoma Spermatogonial stem cell transplantation into rhesus testes regenerates spermatogenesis producing functional sperm Synthetic zinc finger repressors reduce mutant huntingtin expression in the brain of R6/2 mice In vivo maturation of functional renal organoids formed from embryonic cell suspensions Ultrasound-induced release of micropallets with cells Grp94 triage of mutant myocilin through ERAD subverts a more efficient autophagic clearance mechanism Regulatory B cells control T-cell autoimmunity through IL-21-dependent cognate interactions Induced pluripotent stem cell model recapitulates pathologic hallmarks of Gaucher disease Magnetic nanoparticle–mediated massively parallel mechanical modulation of single-cell behavior DNA self-assembly of targeted near-infrared-responsive gold nanoparticles for cancer thermo-chemotherapy Generation of functional thyroid from embryonic stem cells Imaging neural activity using Thy1-GCaMP transgenic mice Characterization of the inflammatory response to solid cancer metastases in the human brain Histopathological correlates of magnetic resonance imaging–defined chronic perinatal white matter injury Neural stem cell engraftment and myelination in the human brain Human neural stem cells induce functional myelination in mice with severe dysmyelination Pursuing the goal of a donor for everyone in need Use of reprogrammed cells to identify therapy for respiratory papillomatosis ROCK inhibitor and feeder cells induce the conditional reprogramming of epithelial cells Cardiovascular risk factors in hematopoietic cell transplantation (HCT) survivors: role in development of subsequent cardiovascular disease Human very small embryonic-like cells generate skeletal structures, in vivo Apoptotic susceptibility to DNA damage of pluripotent stem cells facilitates pharmacologic purging of teratoma risk IFNγR signaling mediates alloreactive T cell trafficking and GvHD Genetic programs constructed from layered logic gates in single cells Offspring from oocytes derived from in vitro primordial germ cell–like cells in mice Reprogramming of pericyte-derived cells of the adult human brain into induced neuronal cells DNA methylation plasticity of human adipose-derived stem cells in lineage commitment New susceptibility loci associated with kidney disease in type 1 diabetes A stable cranial neural crest cell line from mouse Longitudinal trends in resource use in an incident cohort of open-angle glaucoma patients: resource use in open-angle glaucoma Melanomas resist T-cell therapy through inflammation-induced reversible dedifferentiation A combinatorial extracellular matrix platform identifies cell-extracellular matrix interactions that correlate with metastasis In vivo-validated essential genes identified in Acinetobacter baumannii by using human ascites overlap poorly with essential genes detected on laboratory media Single-cell expression analyses during cellular reprogramming reveal an early stochastic and a late hierarchic phase Micro glass ball embedded gels to study cell mechanobiological responses to substrate curvatures Long-distance growth and connectivity of neural stem cells after severe spinal cord injury Identification of a specific reprogramming-associated epigenetic signature in human induced pluripotent stem cells Differentiation of mouse pancreatic stem cells into insulin-producing cells by recombinant sendai virus-mediated gene transfer technology Adipose tissue invariant NKT cells protect against diet-induced obesity and metabolic disorder through regulatory cytokine production A strong regenerative ability of cardiac stem cells derived from neonatal hearts Adiponectin gene therapy ameliorates high-fat, high-sucrose diet-induced metabolic perturbations in mice A kinase inhibitor screen identifies small-molecule enhancers of reprogramming and iPS cell generation Dynamic and coordinated epigenetic regulation of developmental transitions in the cardiac lineage Restoration of auditory evoked responses by human ES-cell-derived otic progenitors Controlling spatial organization of multiple cell types in defined 3D geometries Cancer regression in patients after transfer of genetically engineered lymphocytes Chimeric antigen receptor-modified T cells in chronic lymphoid leukemia T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced leukemia T cells engineered with a T cell receptor against the prostate antigen TARP specifically kill HLA-A2+ prostate and breast cancer cells Induced pluripotency and oncogenic transformation are related processes Distinct contribution of stem and progenitor cells to epidermal maintenance Predicting the diagnosis of autism spectrum disorder using gene pathway analysis Identifying metalloproteins through X-ray fluorescence mapping and mass spectrometry Mesenchymal stem cell transplantation improves regional cardiac remodeling following ovine infarction Comprehensive genomic analysis identifies SOX2 as a frequently amplified gene in small-cell lung cancer δ-Catenin is genetically and biologically associated with cortical cataract and future alzheimer-related structural and functional brain changes Diminished temporal coding with sensorineural hearing loss emerges in background noise Fasting enhances the response of glioma to chemo- and radiotherapy A dense poly(ethylene glycol) coating improves penetration of large polymeric nanoparticles within brain tissue Gene therapy for adenosine deaminase-deficient severe combined immune deficiency: clinical comparison of retroviral vectors and treatment plans Live-cell, temporal gene expression analysis of osteogenic differentiation in adipose-derived stem cells Myocardial protection, perioperative management, and vascular biology Wireless power transfer to a cardiac implant Initiation of transcription-coupled repair characterized at single-molecule resolution Identification, proliferation, and differentiation of adult leydig stem cells NR4A nuclear receptors support memory enhancement by histone deacetylase inhibitors Population-based case-control study of recreational drug use and testis cancer risk confirms an association between marijuana use and nonseminoma risk Suppression of acquired docetaxel resistance in prostate cancer through depletion of notch- and hedgehog-dependent tumor-initiating cells Cis-element mutated in GATA2-dependent immunodeficiency governs hematopoiesis and vascular integrity Flow-regulated endothelial S1P receptor-1 signaling sustains vascular development Direct reprogramming of fibroblasts into embryonic sertoli-like cells by defined factors An RNA virus hijacks an incognito function of a DNA repair enzyme LIN28 binds messenger RNAs at GGAGA motifs and regulates splicing factor abundance Genome-wide association analyses identify three new susceptibility loci for primary angle closure glaucoma The BH3-only proteins Bim and Puma cooperate to impose deletional tolerance of organ-specific antigens The sirtuin SIRT6 regulates lifespan in male mice Sirtuin 6 (SIRT6) rescues the decline of homologous recombination repair during replicative senescence Antitumor activity of the tea polyphenol epigallocatechin-3-gallate encapsulated in targeted vesicles after intravenous administration Amputation induces stem cell mobilization to sites of injury during planarian regeneration Nanostructuring platinum nanoparticles on multilayered graphene petal nanosheets for electrochemical biosensing ALDH1A isozymes are markers of human melanoma stem cells and potential therapeutic targets Gene therapy rescues cilia defects and restores olfactory function in a mammalian ciliopathy model Directed differentiation of human pluripotent stem cells into mature airway epithelia expressing functional CFTR protein Virus-mediated shRNA knockdown of Nav1.3 in rat dorsal root ganglion attenuates nerve injury-induced neuropathic pain Macroporous nanowire nanoelectronic scaffolds for synthetic tissues Formation and optogenetic control of engineered 3D skeletal muscle bioactuators Lymphoid priming in human bone marrow begins before expression of CD10 with upregulation of L-selectin Multifaceted roles of PTEN and TSC orchestrate growth and differentiation of Drosophila blood progenitors Effect of plasmodial RESA protein on deformability of human red blood cells harboring Plasmodium falciparum Pf155/RESA protein influences the dynamic microcirculatory behavior of ring-stage Plasmodium falciparum infected red blood cells Adipose stem cells can secrete angiogenic factors that inhibit hyaline cartilage regeneration Improving dendritic cell vaccine immunogenicity by silencing PD-1 ligands using siRNA-lipid nanoparticles combined with antigen mRNA electroporation Functionalized, biodegradable hydrogels for control over sustained and localized siRNA delivery to incorporated and surrounding cells Clonal evolution of preleukemic hematopoietic stem cells precedes human acute myeloid leukemia Differential trafficking of transport vesicles contributes to the localization of dendritic proteins A universal system for highly efficient cardiac differentiation of human induced pluripotent stem cells that eliminates interline variability Growth factor-activated stem cell circuits and stromal signals cooperatively accelerate non-integrated iPSC reprogramming of human myeloid progenitors Set2 methylation of histone H3 lysine 36 suppresses histone exchange on transcribed genes Partial nerve injury induces electrophysiological changes in conducting (uninjured) nociceptive and nonnociceptive DRG neurons: Possible relationships to aspects of peripheral neuropathic pain and paresthesias Deletion of claudin-10 (Cldn10) in the thick ascending limb impairs paracellular sodium permeability and leads to hypermagnesemia and nephrocalcinosis TrxG and PcG proteins but not methylated histones remain associated with DNA through replication Targeted tumor-penetrating siRNA nanocomplexes for credentialing the ovarian cancer oncogene ID4 Continuous 24-Hour monitoring of intraocular pressure patterns with a contact lens sensor Hypoxia promotes satellite cell self-renewal and enhances the efficiency of myoblast transplantation The mouse lymph node as an ectopic transplantation site for multiple tissues Intestinal inflammation targets cancer-inducing activity of the microbiota Human amniotic fluid stem cell injection therapy for urethral sphincter regeneration in an animal model Instructive nanofiber scaffolds with VEGF create a microenvironment for arteriogenesis and cardiac repair Synthetic riboswitches for external regulation of genes transferred by replication-deficient and oncolytic adenoviruses A voltage-gated sodium channel is essential for the positive selection of CD4+ T cells Phase I trial of a multi-epitope-pulsed dendritic cell vaccine for patients with newly diagnosed glioblastoma The histone acetyltransferase MOF is a key regulator of the embryonic stem cell core transcriptional network Neutrophils mediate insulin resistance in mice fed a high-fat diet through secreted elastase Feeder cells support the culture of induced pluripotent stem cells even after chemical fixation Serum- and stromal cell-free hypoxic generation of embryonic stem cell-derived hematopoietic cells in vitro, capable of multilineage repopulation of immunocompetent mice Intra-articular delivery of purified mesenchymal stem cells from C57BL/6 or MRL/MpJ superhealer mice prevents post-traumatic arthritis First-in-human trial of a STAT3 decoy oligonucleotide in head and neck tumors: implications for cancer therapy Novel, high-yield red blood cell production methods from CD34-positive cells derived from human embryonic stem, yolk sac, fetal liver, cord blood, and peripheral blood Transforming fusions of FGFR and TACC genes in human glioblastoma Proteasome inhibition alleviates SNARE-dependent neurodegeneration Sacrificial nanofibrous composites provide instruction without impediment and enable functional tissue formation Improvements in the life expectancy of type 1 diabetes: The Pittsburgh Epidemiology of Diabetes Complications Study cohort Nicotinamide adenine dinucleotide phosphate oxidase (nox) in experimental liver fibrosis: GKT137831 as a novel potential therapeutic agent Energy-dependent modulation of glucagon-like signaling in Drosophila via the AMP-activated protein kinase FAM83A and FAM83B: candidate oncogenes and TKI resistance mediators FAM83A confers EGFR-TKI resistance in breast cancer cells and in mice FAM83B mediates EGFR- and RAS-driven oncogenic transformation Chronic lymphocytic leukaemia is driven by antigen-independent cell-autonomous signaling Fate-restricted neural progenitors in the mammalian cerebral cortex Mosaic hydrogels: one-step formation of multiscale soft materials Spray-applied cell therapy with human allogeneic fibroblasts and keratinocytes for the treatment of chronic venous leg ulcers: a phase 2, multicentre, double-blind, randomised, placebo-controlled trial Randomized, controlled trial of a sustained delivery formulation of 5-fluorouracil for the treatment of failing blebs Scl represses cardiomyogenesis in prospective hemogenic endothelium and endocardium Regulation of embryonic and induced pluripotency by aurora kinase-p53 signaling Novel atypical PKC inhibitors prevent vascular endothelial growth factor-induced blood–retinal barrier dysfunction The intermediate filament vimentin regulates chondrogenesis of adult human bone marrow-derived multipotent progenitor cells Direct differentiation of human pluripotent stem cells into haploid spermatogenic cells Lipidomics identifies cardiolipin oxidation as a mitochondrial target for redox therapy of brain injury Rationally designed controlled release systems for periodontal disease that promote immunological homeostasis New reservoirs of HLA alleles: pools of rare variants enhance immune defense 1α,25-dihydroxyvitamin D3 modulates the hair-inductive capacity of dermal papilla cells: therapeutic potential for hair regeneration Human ES-cell-derived cardiomyocytes electrically couple and suppress arrhythmias in injured hearts Transcription activator-like effector proteins induce the expression of the Frataxin gene Human apolipoprotein E peptides inhibit hepatitis C virus entry by blocking virus binding RhoC impacts the metastatic potential and abundance of breast cancer stem cells Direct observation of mammalian cell growth and size regulation Neuronal circuitry mechanism regulating adult quiescent neural stem-cell fate decision The mitochondrial targeting chaperone 14-3-3 regulates a RIG-I translocon that mediates membrane association and innate antiviral immunity The RIG-I-like receptor LGP2 controls CD8+ T cell survival and fitness Transcription activator-like effector proteins induce the expression of the Frataxin gene Stat3-mediated activation of microRNA-23a suppresses gluconeogenesis in hepatocellular carcinoma by down-regulating glucose-6-phosphatase and peroxisome proliferator-activated receptor gamma, coactivator 1 alpha Restoration of hearing in the VGLUT3 knockout mouse using virally mediated gene therapy Cord blood-derived neuronal cells by ectopic expression of Sox2 and c-Myc Microwave sintering and in vitro study of defect-free stable porous multilayered HAp–ZrO2 artificial bone scaffold Stem cell therapy for craniofacial bone regeneration: a randomized, controlled, feasibility trial A tissue-engineered jellyfish with biomimetic propulsion Subnetwork-based analysis of chronic lymphocytic leukemia identifies pathways that associate with disease progression c-kit+ precursors support postinfarction myogenesis in the neonatal, but not adult, heart Bioresorbable bone graft substitutes of different osteoconductivities: a histologic evaluation of osteointegration of poly(propylene glycol-co-fumaric acid)-based cement implants in rats Innovative collagen nano-hydroxyapatite scaffolds offer a highly efficient non-viral gene delivery platform for stem cell-mediated bone formation OX40 signaling favors the induction of TH9 cells and airway inflammation Noncanonical Wnt signaling maintains hematopoietic stem cells in the niche The GCTM-5 epitope associated with the mucin-like glycoprotein FCGBP marks progenitor cells in tissues of endodermal origin Cholangiocarcinomas can originate from hepatocytes in mice Paracrine signalling events in embryonic stem cell renewal mediated by affinity targeted nanoparticles Robust tumor immunity to melanoma mediated by interleukin-9–producing T cells Dominance of the CD4+ T helper cell response during acute resolving hepatitis A virus infection Activation of an IL6 inflammatory loop mediates trastuzumab resistance in HER2+ breast cancer by expanding the cancer stem cell population Pharmacological rescue of mitochondrial deficits in iPSC-derived neural cells from patients with familial Parkinson’s Disease Gain and loss of multiple functionally related, horizontally transferred genes in the reduced genomes of two microsporidian parasites Histone modifications and lamin A regulate chromatin protein dynamics in early embryonic stem cell differentiation Rational design of cationic lipids for siRNA delivery Maximizing the potency of siRNA lipid nanoparticles for hepatic gene silencing in vivo Asthmatic granulomatosis: a novel disease with asthmatic and granulomatous features High-definition fiber tractography of the human brain: neuroanatomical validation and neurosurgical applications Direct central nervous system delivery provides enhanced protection following vector mediated gene replacement in a severe model of Spinal Muscular Atrophy Glycerol supplementation enhances L. reuteri’s protective effect against S. Typhimurium colonization in a 3-D model of colonic epithelium Combination delivery of TGF-β inhibitor and IL-2 by nanoscale liposomal polymeric gels enhances tumour immunotherapy Inhibition of RNA polymerase I as a therapeutic strategy to promote cancer-specific activation of p53 The LIM protein Ajuba restricts the second heart field progenitor pool by regulating Isl1 activity Anti-inflammatory mesenchymal stem cells (MSC2) attenuate symptoms of painful diabetic peripheral neuropathy Ultraviolet radiation damages self noncoding RNA and is detected by TLR3 Aneuploidy as a mechanism for stress-induced liver adaptation Novel vascular endothelial growth factor gene delivery system-manipulated mesenchymal stem cells repair infarcted myocardium Endothelial CCR2 signaling induced by colon carcinoma cells enables extravasation via the JAK2-Stat5 and p38MAPK pathway Sequencing chromosomal abnormalities reveals neurodevelopmental loci that confer risk across diagnostic boundaries Oligodendroglia metabolically support axons and contribute to neurodegeneration Properties of mechano-transduction via simulated microgravity and its effects on intracellular trafficking of VEGFR’s Induced pluripotent stem cells from patients with Huntington's disease show CAG-repeat-expansion-associated phenotypes Pharmacological rescue of mitochondrial deficits in iPSC-derived neural cells from patients with familial Parkinson’s disease Histone demethylases KDM4B and KDM6B promotes osteogenic differentiation of human MSCs Derivation conditions impact X-inactivation status in female human induced pluripotent stem cells High-throughput single-microparticle imaging flow analyzer Beige adipocytes are a distinct type of thermogenic fat cell in mouse and human Long-term remission of diabetes in NOD mice is induced by nondepleting anti-CD4 and anti-CD8 antibodies Topical delivery of siRNA-based spherical nucleic acid nanoparticle conjugates for gene regulation Valproic acid confers functional pluripotency to human amniotic fluid stem cells in a transgene-free approach Rapid casting of patterned vascular networks for perfusable engineered three-dimensional tissues Targeted gene knockout by direct delivery of zinc-finger nuclease proteins Reprogramming of tRNA modifications controls the oxidative stress response by codon-biased translation of proteins Adoptive transfer of immunomodulatory M2 macrophages prevents type 1 diabetes in NOD mice Identification of new susceptibility loci for osteoarthritis (arcOGEN): a genome-wide association study Adult hematopoietic progenitors are multipotent in chimeric mice Follicular dendritic cells emerge from ubiquitous perivascular precursors Soft fibrin gels promote selection and growth of tumorigenic cells Manual wheelchair skills capacity predicts quality of life and community integration in persons with spinal cord injury Neo-vascularization of the stroke cavity by implantation of human neural stem cells on VEGF-releasing PLGA microparticles Metformin activates an atypical PKC-CBP pathway to promote neurogenesis and enhance spatial memory formation Increased asymmetric and multi-daughter cell division in mechanically confined microenvironments Serum apolipoproteins are associated with systemic and retinal microvascular function in people with diabetes DNA methylome signature in rheumatoid arthritis Transplantation of genetically corrected human iPSC-derived progenitors in mice with limb-girdle Muscular Dystrophy Induced pluripotent stem cells from patients with Huntington's Disease show CAG-repeat-expansion-associated phenotypes Synthetic homeostatic materials with chemo-mechano-chemical self-regulation Endoscopic therapy is effective for patients with chronic pancreatitis Maturation of human embryonic stem cell–derived pancreatic progenitors into functional islets capable of treating pre-existing diabetes in mice Production and implantation of renal extracellular matrix scaffolds from porcine kidneys as a platform for renal bioengineering investigations De novo somatic mutations in components of the PI3K-AKT3-mTOR pathway cause hemimegalencephaly Can magnetic targeting of magnetically labeled circulating cells optimize intramyocardial cell retention? Glucose deprivation activates a metabolic and signaling amplification loop leading to cell death Id proteins synchronize stemness and anchorage to the niche of neural stem cells Fates of murine pluripotent stem cell-derived neural progenitors following transplantation into mouse cochleae Induced pluripotent stem cells from patients with Huntington's disease show CAG-repeat-expansion-associated phenotypes Genetic correction of Huntington's disease phenotypes in induced pluripotent stem cells Derivation of blood-brain barrier endothelial cells from human pluripotent stem cells In vivo reprogramming of murine cardiac fibroblasts into induced cardiomyocytes Induced pluripotent stem cells from a spinal muscular atrophy patient Inhibition of apoptosis blocks human motor neuron cell death in a stem cell model of spinal muscular atrophy MicroRNA profiling of carcinogen-induced rat colon tumors and the influence of dietary spinach Embryonic stem cell potency fluctuates with endogenous retrovirus activity Self-formation of optic cups and storable stratified neural retina from human ESCs Simultaneous voltage and calcium mapping of genetically purified human induced pluripotent stem cell–derived cardiac myocyte monolayers Targeted delivery of PLK1-siRNA by ScFv suppresses Her2+ breast cancer growth and metastasis ROCK inhibitor converts corneal endothelial cells into a phenotype capable of regenerating in vivo endothelial tissue Matrix rigidity controls endothelial differentiation and morphogenesis of cardiac precursors Two-compartment tumor metabolism: Autophagy in the tumor microenvironment and oxidative mitochondrial metabolism (OXPHOS) in cancer cells Autophagy and senescence in cancer-associated fibroblasts metabolically supports tumor growth and metastasis via glycolysis and ketone production CTGF drives autophagy, glycolysis and senescence in cancer-associated fibroblasts via HIF1 activation, metabolically promoting tumor growth The Ets transcription factor Spi-B is essential for the differentiation of intestinal microfold cells The transcriptional and epigenomic foundations of ground state pluripotency Extracellular-matrix tethering regulates stem-cell fate Evolutionary selection of enzymatically synthesized semiconductors from biomimetic mineralization vesicles Direct reprogramming of mouse and human fibroblasts into multipotent neural stem cells with a single factor Brain expression Genome-Wide Association Study (eGWAS) identifies human disease-associated variants Generation of an HIV-1-resistant immune system with CD34+ hematopoietic stem cells transduced with a triple-combination anti-HIV lentiviral vector A combined micromagnetic-microfluidic device for rapid capture and culture of rare circulating tumor cells Liver tissue engineering utilizing hepatocytes propagated in mouse livers in vivo Intracellular trafficking pathways involved in the gene transfer of nano-structured calcium phosphate-DNA particles Clonally dominant cardiomyocytes direct heart morphogenesis SIV replication in the infected rhesus macaque is limited by the size of the preexisting TH17 cell compartment Phage-based molecular probes that discriminate force-induced structural states of fibronectin in vivo Perivascular stem cells: a prospectively purified mesenchymal stem cell population for bone tissue engineering MicroRNA-mediated in vitro and in vivo direct reprogramming of cardiac fibroblasts to Cardiomyocytes Differentiation of multipotent vascular stem cells contributes to vascular diseases Common variants at 9p21 and 8q22 are associated with increased susceptibility to optic nerve degeneration in glaucoma Flow mechanotransduction regulates traction forces, intercellular forces, and adherens junctions Human epidermal Langerhans Cells maintain immune homeostasis in skin by activating skin resident regulatory T cells Recurrent variations in DNA methylation in human pluripotent stem cells and their differentiated derivatives Human embryonic stem cells have constitutively active Bax at the Golgi and are primed to undergo rapid apoptosis Adhesion failures determine the pattern of choroidal neovascularization in the eye: a computer simulation study Notch ligand endocytosis generates mechanical pulling force dependent on dynamin, epsins, and actin Optical tweezers studies on notch: single-molecule interaction strength is independent of ligand endocytosis Inhibitory receptors bind ANGPTLs and support blood stem cells and leukaemia development Functional neuromuscular junctions formed by embryonic stem cell-derived motor neurons NF-κB inhibition delays DNA damage–induced senescence and aging in mice Amniotic fluid inhibits Toll-like receptor 4 signaling in the fetal and neonatal intestinal epithelium Human ES- and iPS-derived myogenic progenitors restore DYSTROPHIN and improve contractility upon transplantation in dystrophic mice The PSA/lo prostate cancer cell population harbors self-renewing long-term tumor-propagating cells that resist castration Low incidence of DNA sequence variation in human induced pluripotent stem cells generated by nonintegrating plasmid expression Cdc42 activity regulates hematopoietic stem cell aging and rejuvenation Divergent transcriptional programming of class-specific B cell memory by T-bet and RORα Genome-wide RNAi screening identifies human proteins with a regulatory function in the early secretory pathway Single cell profiling of circulating tumor cells: transcriptional heterogeneity and diversity from breast cancer cell lines A cluster of cooperating tumor-suppressor gene candidates in chromosomal deletions Caffeic acid phenethyl ester suppresses the proliferation of human prostate cancer cells through inhibition of p70S6K and Akt signaling networks Circulating tumour cells in non-metastatic breast cancer: a prospective study Histone H1 depletion impairs embryonic stem cell differentiation Regulation of TH2 development by CXCR5+ dendritic cells and lymphotoxin-expressing B cells Identification of drugs including a dopamine receptor antagonist that selectively target cancer stem cells Ganglioside GD2 identifies breast cancer stem cells and promotes tumorigenesis Sphingosine-1-phosphate enhances satellite cell activation in dystrophic muscles through a S1PR2/STAT3 signaling pathway Decade-long safety and function of retroviral-modified chimeric antigen receptor T cells Mind bomb 1 is required for pancreatic β-cell formation Role of stem cells in human uterine leiomyoma growth Metabolite profiling identifies a key role for glycine in rapid cancer cell proliferation Derivation of mesenchymal stem cells from human induced pluripotent stem cells cultured on synthetic substrates Light-triggered eradication of Acinetobacter baumannii by means of NO delivery from a porous material with an entrapped metal nitrosyl Mesenchymal-stem-cell-induced immunoregulation involves FAS-ligand-/FAS-mediated T cell apoptosis A clinical and serologic comparison of African-American and Caucasian patients with systemic sclerosis Defective B cell tolerance in adenosine deaminase deficiency is corrected by gene therapy Foxp-mediated suppression of N-cadherin regulates neuroepithelial character and progenitor maintenance in the CNS Robust cardiomyocyte differentiation from human pluripotent stem cells via temporal modulation of canonical Wnt signaling Molecular analysis of FMR1 reactivation in fragile-X induced pluripotent stem cells and their neuronal derivatives Prevention of allogeneic fetal rejection by tryptophan catabolism Macrophage activation associated with chronic murine cytomegalovirus infection results in more severe experimental choroidal neovascularization Engineering DNA nanoparticles as immunomodulatory reagents that activate regulatory T cells Astrocytes secrete exosomes enriched with pro-apoptotic ceramide and prostate apoptosis response 4 (PAR-4): a potential mechanism of apoptosis induction in Alzheimer's disease (AD) Opiate antagonist prevents μ- and δ-opiate receptor dimerization to facilitate ability of agonist to control ethanol-altered natural killer cell functions and mammary tumor growth The landscape of cancer genes and mutational processes in breast cancer Oscillatory dynamics of Cdc42 GTPase in the control of polarized growth Allele-specific p53 mutant reactivation Photovoltaic retinal prosthesis with high pixel density Atoh1 directs the formation of sensory mosaics and induces cell proliferation in the postnatal mammalian cochlea in vivo Engineering bone tissue from human embryonic stem cells Cellular mechanical properties reflect the differentiation potential of adipose-derived mesenchymal stem cells Hepatocyte growth factor mediates mesenchymal stem cell–induced recovery in multiple sclerosis models KCTD13 is a major driver of mirrored neuroanatomical phenotypes of the 16p11.2 copy number variant A peptide derived from endostatin ameliorates organ fibrosis Multipotent stromal stem cells from human placenta demonstrate high therapeutic potential Derivation and cardiomyocyte differentiation of induced pluripotent stem cells from heart failure patients Gene therapy for aromatic l-amino acid decarboxylase deficiency Anticancer PAD inhibitors regulate the autophagy flux and the mammalian target of rapamycin complex 1 activity Glioma gene therapy using induced pluripotent stem cell derived neural stem cells Tumor tropism of intravenously injected human-induced pluripotent stem cell-derived neural stem cells and their gene therapy application in a metastatic breast cancer model Live-cell delamination counterbalances epithelial growth to limit tissue overcrowding Crowding induces live cell extrusion to maintain homeostatic cell numbers in epithelia Risk and reward in stem cell products: a new model for stem cell product liability Regenerative medicine: DIY eye Restoration of vision after transplantation of photoreceptors Sequencing chromosomal abnormalities reveals neurodevelopmental loci that confer risk across diagnostic boundaries Enhanced homing permeability and retention of bone marrow stromal cells by noninvasive pulsed focused ultrasound In vivo suppression of HIV by antigen specific T cells derived from engineered hematopoietic stem cells Identification of common variants associated with human hippocampal and intracranial volumes Inactivation of conserved c. elegans genes engages pathogen- and xenobiotic-associated defenses Host translational inhibition by pseudomonas aeruginosa exotoxin A triggers an immune response in caenorhabditis elegans C. elegans detects pathogen-induced translational inhibition to activate immune signaling Patient-specific induced pluripotent stem cells as a model for familial dilated cardiomyopathy The adult human brain harbors multipotent perivascular mesenchymal stem cells Fully functional hair follicle regeneration through the rearrangement of stem cells and their niches Derivation, expansion and differentiation of induced pluripotent stem cells in continuous suspension cultures Small molecules enable highly efficient neuronal conversion of human fibroblasts Antibiotic resistance is prevalent in an isolated cave microbiome Arsenic-transformed malignant prostate epithelia can convert noncontiguous normal stem cells into an oncogenic phenotype Nrf2-dependent induction of proteasome and Pa28αβ regulator are required for adaptation to oxidative stress De novo mutations revealed by whole-exome sequencing are strongly associated with autism Patterns and rates of exonic de novo mutations in autism spectrum disorders Sporadic autism exomes reveal a highly interconnected protein network of de novo mutations Adeno associated viral vector-mediated expression of somatostatin in rat hippocampus suppresses seizure development ESCRT-III governs the Aurora B–mediated abscission checkpoint through CHMP4C Genetic and pharmacologic inhibition of β-catenin targets imatinib-resistant leukemia stem cells in CML Distinct lineage specification roles for NANOG, OCT4, and SOX2 in human embryonic stem cells NOD2 triggers an interleukin-32–dependent human dendritic cell program in leprosy Nighttime intensivist staffing and mortality among critically ill patients The Arp2/3 complex is required for lamellipodia extension and directional fibroblast cell migration Self-renewing endodermal progenitor lines generated from human pluripotent stem cells NLRP3 has a protective role in age-related macular degeneration through the induction of IL-18 by drusen components MRI-guided disruption of the blood-brain barrier using transcranial focused ultrasound in a rat model Rapid and sensitive detection of an intracellular pathogen in human peripheral leukocytes with hybridizing magnetic relaxation nanosensors A genome-wide association meta-analysis identifies new childhood obesity loci Direct observation of nanoparticle–cancer cell nucleus interactions Efficient derivation of purified lung and thyroid progenitors from embryonic stem cells DNA/amphiphilic block copolymer nanospheres reduce asthmatic response in a mouse model of allergic asthma Extracellular matrix protein CCN1 limits oncolytic efficacy in glioma Ultrathin transnasal endoscopy without sedation: the straight skinny Feasibility, safety, acceptability, and yield of office-based, screening transnasal esophagoscopy (with video) A biohybrid device for the systemic control of acute inflammation Timing isn't everything: donor heart allocation in the present LVAD era Risk assessment for continuous flow left ventricular assist devices: does the destination therapy risk score work?: an analysis of over 1,000 patients Kidney attack Genome abnormalities precede prostate cancer and predict clinical relapse REST-mediated recruitment of polycomb repressor complexes in mammalian cells Blood-derived human ips cells generate optic vesicle–like structures with the capacity to form retinal laminae and develop synapses Macrophage-derived Wnt opposes Notch signaling to specify hepatic progenitor cell fate in chronic liver disease Sleeping Beauty mutagenesis reveals cooperating mutations and pathways in pancreatic adenocarcinoma Genome-wide polycomb target gene prediction in Drosophila melanogaster Multiple intravenous administrations of human umbilical cord blood cells benefit in a mouse model of ALS Role of RhoA-specific guanine exchange factors in regulation of endomitosis in megakaryocytes Exogenous leukemia inhibitory factor stimulates oligodendrocyte progenitor cell proliferation and enhances hippocampal remyelination A rat decellularized small bowel scaffold that preserves villus-crypt architecture for intestinal regeneration Codanin-1, mutated in the anaemic disease CDAI, regulates Asf1 function in S-phase histone supply Arp2/3 is critical for lamellipodia and response to extracellular matrix cues but is dispensable for chemotaxis Genetic regulators of a pluripotent adult stem cell system in planarians identified by RNAi and clonal analysis DNA demethylation dynamics Acute exercise remodels promoter methylation in human skeletal muscle A telomere-dependent DNA damage checkpoint induced by prolonged mitotic arrest Infection-responsive expansion of the hematopoietic stem and progenitor cell compartment in zebrafish is dependent upon inducible nitric oxide Inhibiting autophagy during interleukin 2 immunotherapy promotes long term tumor regression A two-compartment mathematical model of endotoxin-induced inflammatory and physiologic alterations in swine Oxidized mitochondrial DNA activates the NLRP3 inflammasome during apoptosis Parkin controls dopamine utilization in human midbrain dopaminergic neurons derived from induced pluripotent stem cells AAV2 gene therapy readministration in three adults with congenital blindness Induction therapy with autologous mesenchymal stem cells in living-related kidney transplants Germline stem cells and follicular renewal in the postnatal mammalian ovary Production of offspring from a germline stem cell line derived from neonatal ovaries Oocyte formation by mitotically active germ cells purified from ovaries of reproductive-age women Targeting the epidermal growth factor receptor in non-small cell lung cancer cells: the effect of combining RNA interference with tyrosine kinase inhibitors or cetuximab Catheter-deliverable hydrogel derived from decellularized ventricular extracellular matrix increases endogenous cardiomyocytes and preserves cardiac function post-myocardial infarction A human stem cell model of early Alzheimer’s disease pathology in Down Syndrome Human embryonic stem cell-derived GABA neurons correct locomotion deficits in quinolinic acid-lesioned mice PNPASE regulates RNA import into mitochondria Correcting human mitochondrial mutations with targeted RNA import Blood-derived human ips cells generate optic vesicle–like structures with the capacity to form retinal laminae and develop synapses Direct reprogramming of fibroblasts into neural stem cells by defined factors Effect of transendocardial delivery of autologous bone marrow mononuclear cells on functional capacity, left ventricular function, and perfusion in chronic heart failure A model for personalized in vivo analysis of human immune responsiveness Role of lentivirus-mediated overexpression of programmed death-ligand 1 on corneal allograft survival Human platelet-rich plasma- and extracellular matrix-derived peptides promote impaired cutaneous wound healing in vivo Bioactive peptides derived from vascular endothelial cell extracellular matrices promote microvascular morphogenesis and wound healing in vitro Long-term gene therapy causes transgene-specific changes in the morphology of regenerating retinal ganglion cells Direct conversion of fibroblasts into stably expandable neural stem cells Wild-type microglia arrest pathology in a mouse model of Rett syndrome Self-assembled RNA interference microsponges for efficient siRNA delivery Generation of functional insulin-producing cells in the gut by Foxo1 ablation Multi-input RNAi-based logic circuit for identification of specific cancer cells Lumbar intraspinal injection of neural stem cells in patients with ALS: results of a phase I trial in 12 patients Improvement of islet function in a bioartificial pancreas by enhanced oxygen supply and growth hormone releasing hormone agonist Transferred melanoma-specific CD8+ T cells persist, mediate tumor regression, and acquire central memory phenotype Human Müller glia with stem cell characteristics differentiate into retinal ganglion cell (RGC) precursors in vitro and partially restore RGC function in vivo following transplantation Mutant induced pluripotent stem cell lines recapitulate aspects of TDP-43 proteinopathies and reveal cell-specific vulnerability Gene therapy for Leber Congenital Amaurosis caused by RPE65 mutations Sox2+ adult stem and progenitor cells are important for tissue regeneration and survival of mice Complement factor H binds malondialdehyde epitopes and protects from oxidative stress BikDD eliminates breast cancer initiating cells and synergizes with lapatinib for breast cancer treatment An alternative splicing switch regulates embryonic stem cell pluripotency and reprogramming Adult spinal cord radial glia display a unique progenitor phenotype Substance use disorder and the risk of open-angle glaucoma The determination of stem cell fate by 3D scaffold structures through the control of cell shape Scanning probe-enabled nanocombinatorics define the relationship between fibronectin feature size and stem cell fate Direct signaling from astrocytes to neurons in cultures of mammalian brain cells Extracellular Ca2+ acts as a mediator of communication from neurons to glia Therapeutic angiogenesis due to balanced single-vector delivery of VEGF and PDGF-BB Hierarchical genetic organization of human cortical surface area Towards regenerative therapy for cardiac disease A novel ChREBP isoform in adipose tissue regulates systemic glucose metabolism Synergistic effects of central nervous system-directed gene therapy and bone marrow transplantation in the murine model of infantile neuronal ceroid lipofuscinosis Association of TPH1, TPH2, and 5HTTLPR with PTSD and depressive symptoms A versatile synthetic platform for a wide range of functionalized biomaterials The development and fate of follicular helper T cells defined by an IL-21 reporter mouse Mechanical unloading reverses transverse tubule remodelling and normalizes local Ca2+-induced Ca2+release in a rodent model of heart failure Inflammatory ocular adverse events with the use of oral bisphosphonates: a retrospective cohort study Estrogen negatively regulates epithelial wound healing and protective lipid mediator circuits in the cornea Synergistic, context-dependent, and hierarchical functions of epithelial components in thymic microenvironments Wnt signaling regulates acetylcholine receptor translocation and synaptic plasticity in the adult nervous system Therapeutic hemoglobin levels after gene transfer in β-thalassemia mice and in hematopoietic cells of β-thalassemia and sickle cells disease patients Nanocomposite materials with antimicrobial activity based on chitosan Cancer stem cell vaccination confers significant antitumor immunity Antitelomerase therapy provokes ALT and mitochondrial adaptive mechanisms in cancer Functionalized conducting polymer nanodots for enhanced cell capturing: the synergistic effect of capture agents and nanostructures Oral mucosal progenitor cells are potently immunosuppressive in a dose-independent manner Differentiation potential of germ line stem cells derived from the postnatal mouse ovary Production of offspring from a germline stem cell line derived from neonatal ovaries Bone marrow transplantation generates immature oocytes and rescues long-term fertility in a preclinical mouse model of chemotherapy-induced premature ovarian failure Oocyte generation in adult mammalian ovaries by putative germ cells in bone marrow and peripheral blood Germline stem cells and follicular renewal in the postnatal mammalian ovary Oocyte formation by mitotically active germ cells purified from ovaries of reproductive-age women Cooperation between both Wnt/β-catenin and PTEN/PI3K/Akt signaling promotes primitive hematopoietic stem cell self-renewal and expansion Antibody-functionalized fluid-permeable surfaces for rolling cell capture at high flow rates Mechanical resuscitation of chemical oscillations in Belousov–Zhabotinsky gels Position-specific chemical modification and quantitative proteomics disclose protein orientation adsorbed on silica nanoparticles Isolation and in vitro expansion of human colonic stem cells De novo mutations in the actin genes ACTB and ACTG1 cause Baraitser-Winter syndrome SUMO1-dependent modulation of SERCA2a in heart failure Specific lectin biomarkers for isolation of human pluripotent stem cells identified through array-based glycomic analysis CT angiography for safe discharge of patients with possible acute coronary syndromes Myeloid progenitor cells in the premetastatic lung promote metastases by inducing mesenchymal to epithelial transition The competitive advantage of a dual-transporter system Intravital imaging of thymopoiesis reveals dynamic lympho-epithelial interactions Maintenance of muscle stem-cell quiescence by microRNA-489 Directional DNA methylation changes and complex intermediate states accompany lineage specificity in the adult hematopoietic compartment A metalloproteinase secreted by Streptococcus pneumoniae removes membrane mucin MUC16 from the epithelial glycocalyx barrier Young dentate granule cells mediate pattern separation, whereas old granule cells facilitate pattern completion Nanowired three-dimensional cardiac patches Development of skin-humanized mouse models of pachyonychia congenital Left-right symmetry breaking in tissue morphogenesis via cytoskeletal mechanics A systematic survey of loss-of-function variants in human protein-coding genes Truncations of titin causing dilated cardiomyopathy Myeloid dendritic cells isolated from tissues of SIV-infected Rhesus macaques promote the induction of regulatory T cells Radiation-induced reprograming of breast cancer cells SAMHD1 restricts the replication of human immunodeficiency virus type 1 by depleting the intracellular pool of deoxynucleoside triphosphates Derivation and characterization of embryonic stem cells lines derived from transgenic fischer 344 and dark agouti rats HLA-mismatched renal transplantation without maintenance immunosuppression Chimerism and tolerance without GVHD or engraftment syndrome in HLA-mismatched combined kidney and hematopoietic stem cell transplantation Transcriptional activation by Oct4 is sufficient for the maintenance and induction of pluripotency Combinatorial activation and repression by seven transcription factors specify drosophila odorant receptor expression Human Müller glia with stem cell characteristics differentiate into retinal ganglion cell (RGC) precursors in vitro and partially restore RGC function in vivo following transplantation Choice-specific sequences in parietal cortex during a virtual-navigation decision task Glaucoma 2.0: neuroprotection, neuroregeneration, neuroenhancement Tissue engineering a fetal membrane High levels of circulating CD34+ cells at autologous stem cell collection are associated with favourable prognosis in multiple myeloma A human memory T cell subset with stem cell–like properties PDGFRβ expression and function in fibroblasts derived from pluripotent cells is linked to DNA demethylation Genome-wide polycomb target gene prediction in Drosophila melanogaster Intraocular pressure and corneal biomechanics in an adult British population: the EPIC-Norfolk eye study Targeted gene correction of α1-antitrypsin deficiency in induced pluripotent stem cells Correction of sickle cell disease in adult mice by interference with fetal hemoglobin silencing Direct lineage conversion of terminally differentiated hepatocytes to functional neurons Distal airway stem cells yield alveoli in vitro and during lung regeneration following H1N1 influenza infection A rare penetrant mutation in CFH confers high risk of age-related macular degeneration Effect of intracoronary delivery of autologous bone marrow mononuclear cells 2 to 3 weeks following acute myocardial infarction on left ventricular function: the LateTIME randomized trial Sox2+ adult stem and progenitor cells are important for tissue regeneration and survival of mice Sequence- and target-independent angiogenesis suppression by siRNA via TLR3 Short-interfering RNAs induce retinal degeneration via TLR3 and IRF3 Human oocytes reprogram somatic cells to a pluripotent state Innate lymphoid cells promote lung-tissue homeostasis after infection with influenza virus Targeted focal adhesion kinase activation in cardiomyocytes protects the heart from ischemia/reperfusion injury Trophoblasts regulate the placental hematopoietic niche through PDGF-B signaling Adult mice generated from induced pluripotent stem cells Genome sequencing of mouse induced pluripotent stem cells reveals retroelement stability and infrequent DNA rearrangement during reprogramming Lipotoxicity causes multisystem organ failure and exacerbates acute pancreatitis in obesity Effect of donor—recipient HLA matching at HLA A, B, C, and DRB1 on outcomes after umbilical-cord blood transplantation for leukaemia and myelodysplastic syndrome: a retrospective analysis AMD1 is essential for ESC self-renewal and is translationally down-regulated on differentiation to neural precursor cells Engineered whole organs and complex tissues Inducible apoptosis as a safety switch for adoptive cell therapy Rejuvenating senescent and centenarian human cells by reprogramming through the pluripotent state Interconversion between intestinal stem cell populations in distinct niches Lyn is a redox sensor that mediates leukocyte wound attraction in vivo Young dentate granule cells mediate pattern separation, whereas old granule cells facilitate pattern completion Cross-presentation of tumour antigens by human induced pluripotent stem cell-derived CD141+XCR1+ dendritic cells Restoration of normal BMP signaling levels and osteogenic differentiation in FOP mesenchymal progenitor cells by mutant allele-specific targeting Hydrogen sulfide increases hepatic differentiation in tooth-pulp stem cells Multiple stromal populations contribute to pulmonary fibrosis without evidence for epithelial to mesenchymal transition Single-cell dissection of transcriptional heterogeneity in human colon tumors Dedifferentiation-reprogrammed mesenchymal stem cells with improved therapeutic potential Engineered cell homing Fluid biopsy for circulating tumor cell identification in patients with early-and late-stage non-small cell lung cancer: a glimpse into lung cancer biology High-definition imaging of circulating tumor cells and associated cellular events in non-small cell lung cancer patients: a longitudinal analysis Cytometric comparisons between circulating tumor cells from prostate cancer patients and the prostate-tumor-derived LNCaP cell line Characterization of circulating tumor cell aggregates identified in patients with epithelial tumors Fluid biopsy in patients with metastatic prostate, pancreatic and breast cancers BRCA1 is an essential regulator of heart function and survival following myocardial infarction BRCA2 protein deficiency exaggerates doxorubicin-induced cardiomyocyte apoptosis and cardiac failure Mer receptor tyrosine kinase inhibition impedes glioblastoma multiforme migration and alters cellular morphology Cigarette smoke induction of osteopontin (SPP1) mediates TH17 inflammation in human and experimental emphysema Amyloid fibril formation by the glaucoma-associated olfactomedin domain of myocilin Legionella pneumophila regulates the small GTPase Rab1 activity by reversible phosphorylcholination Mitochondrial respiratory capacity is a critical regulator of CD8+ T cell memory development Sca-1+ cardiosphere-derived cells are enriched for Isl1-expressing cardiac precursors and improve cardiac function after myocardial injury Saccade-confounded image statistics explain visual crowding Pericyte depletion results in hypoxia-associated epithelial-to-mesenchymal transition and metastasis mediated by met signaling pathway Small molecule induction of human umbilical stem cells into myelin basic protein positive oligodendrocytes in a defined three-dimensional environment Time trends in the incidence and causes of blindness in Israel Incidence of legal blindness from age-related macular degeneration in Denmark: year 2000 to 2010 Spider silk inspired functional microthreads Bile acid and inflammation activate gastric cardia stem cells in a mouse model of Barrett-like metaplasia The resistance of breast cancer stem cells to conventional hyperthermia and their sensitivity to nanoparticle-mediated photothermal therapy Cancer exome analysis reveals a T-cell-dependent mechanism of cancer immunoediting Exogenous leukemia inhibitory factor stimulates oligodendrocyte progenitor cell proliferation and enhances hippocampal remyelination Effective treatment of metastatic forms of Epstein-Barr virus–associated nasopharyngeal carcinoma with a novel adenovirus-based adoptive immunotherapy Direct conversion of mouse fibroblasts to self-renewing, tripotent neural precursor cells Ret is a multifunctional coreceptor that integrates diffusible- and contact-axon guidance signals Transplantation of human embryonic stem cells onto a partially wounded human cornea in vitro Small molecule mesengenic induction of human induced pluripotent stem cells to generate mesenchymal stem/stromal cells Freeze-dried heart valve scaffolds A CD74-dependent MHC class I endolysosomal cross-presentation pathway Low-pressure foaming: a novel method for the fabrication of porous scaffolds for tissue engineering Halofuginone and other febrifugine derivatives inhibit prolyl-tRNA synthetase Evaluation of endothelial cells differentiated from amniotic fluid-derived stem cells Directing mesenchymal stem cells to bone to augment bone formation and increase bone mass Lithocholic bile acid selectively kills neuroblastoma cells, while sparing normal neuronal cells Functional inhibition of osteoblastic cells in an in vivo mouse model of myeloid leukemia Osteoblastic cells regulate the haematopoietic stem cell niche Synthetic mast-cell granules as adjuvants to promote and polarize immunity in lymph nodes Probing sporadic and familial Alzheimer’s disease using induced pluripotent stem cells Modeling hepatitis C virus infection using human induced pluripotent stem cells Generation of reactive oxygen species by grape seed extract causes irreparable DNA damage leading to G2/M arrest and apoptosis selectively in head and neck squamous cell carcinoma cells Endothelial and perivascular cells maintain haematopoietic stem cells Distinguishing DNA by analog-to-digital-like conversion by using optofluidic lasers Prostaglandin E2 promotes intestinal tumor growth via DNA methylation Rare variants in APP, PSEN1 and PSEN2 increase risk for AD in late-onset Alzheimer's Disease families Genetic instability in neural stem cells: an inconvenient truth? Novel histone demethylase LSD1 inhibitors selectively target cancer cells with pluripotent stem cell properties Recurrent genomic instability of chromosome 1q in neural derivatives of human embryonic stem cells Blocking of CDCP1 cleavage in vivo prevents Akt-dependent survival and inhibits metastatic colonization through PARP1-mediated apoptosis of cancer cells Hydrogels with time-dependent material properties enhance cardiomyocyte differentiation in vitro Gene therapy rescues photoreceptor blindness in dogs and paves the way for treating human X-linked retinitis pigmentosa Embryonic stem cell trials for macular degeneration: a preliminary report Betacellulin promotes cell proliferation in the neural stem cell niche and stimulates neurogenesis Incidence and clinical characteristics of thyroid cancer in prospective series of individuals with Cowden and Cowden-Like Syndrome characterized by germline PTEN, SDH, or KLLN alterations DUX4 activates germline genes, retroelements, and immune mediators: implications for facioscapulohumeral dystrophy Somatic progenitor cell vulnerability to mitochondrial DNA mutagenesis underlies progeroid phenotypes in polg mutator mice Generation of chimeric rhesus monkeys Glucose-independent glutamine metabolism via TCA cycling for proliferation and survival in B cells Tyrosine phosphorylation of mitochondrial pyruvate dehydrogenase kinase 1 is important for cancer metabolism RNA-guided RNA cleavage by a CRISPR RNA-Cas protein complex Essential features and rational design of CRISPR RNAs that function with the Cas RAMP module complex to cleave RNAs Adult human RPE can be activated into a multipotent stem cell that produces mesenchymal derivatives A single autoimmune T cell receptor recognizes more than a million different peptides Structural basis for the killing of human beta cells by CD8+ T cells in type 1 diabetes Meta-analysis of genome-wide association studies identifies three new risk loci for atopic dermatitis Rejuvenation of regeneration in the aging central nervous system Reversal of type 1 diabetes via islet beta cell regeneration following immune modulation by cord blood-derived multipotent stem cells Generation of human vascular smooth muscle subtypes provides insight into embryological origin–dependent disease susceptibility Dendritic cells promote pancreatic viability in mice with acute pancreatitis Human bone marrow hematopoietic stem cells are increased in frequency and myeloid-biased with age Fetal cells traffic to injured maternal myocardium and undergo cardiac differentiation Human embryonic stem cell-derived neurons adopt and regulate the activity of an established neural network Using iPSC-derived neurons to uncover cellular phenotypes associated with Timothy syndrome p63 regulates olfactory stem cell self-renewal and differentiation Antibody-based protection against HIV infection by vectored immunoprophylaxis Efficient correction of hemoglobinopathy-causing mutations by homologous recombination in integration-free patient iPSCs Rational bioprocess design for human pluripotent stem cell expansion and endoderm differentiation based on cellular dynamics Focal adhesion kinase links mechanical force to skin fibrosis via inflammatory signaling Demographic and geographic features of exfoliation glaucoma in 2 United States-based prospective cohorts The nuclear receptor PPARβ/δ programs muscle glucose metabolism in cooperation with AMPK and MEF2 Adult cardiac-resident MSC-like stem cells with a proepicardial origin Charge inversion, condensation and decondensation of DNA and polystyrene sulfonate by polyethylenimine Polycomb-repressed genes have permissive enhancers that initiate reprogramming MicroRNA-520/373 family functions as a tumor suppressor in estrogen receptor negative breast cancer by targeting NF-κB and TGF-β signaling pathways Optimization of immunosuppressive therapy for spinal grafting of human spinal stem cells in a rat model of ALS Acquisition of a multifunctional IgA+ plasma cell phenotype in the gut Bone marrow contributes simultaneously to different neural types in the central nervous system through different mechanisms of plasticity The STARD9/Kif16a kinesin associates with mitotic microtubules and regulates spindle pole assembly FT1050 (16,16-dimethyl prostaglandin e2)-enhanced umbilical cord blood accelerates hematopoietic engraftment after reduced intensity conditioning and double umbilical cord blood transplantation A SUMOylation-dependent transcriptional subprogram is required for Myc-driven tumorigenesis Adenovirus-associated virus vector–mediated gene transfer in hemophilia B A trial of intrapleural adenoviral-mediated interferon-α2b gene transfer for malignant pleural mesothelioma Th17 cells mediate clade-specific, serotype-independent mucosal immunity Implantation site and lesion topology determine efficacy of a human neural stem cell line in a rat model of chronic stroke ΔNp63α protein triggers epithelial-mesenchymal transition and confers stem cell properties in normal human keratinocytes Mutations in MEGF10, a regulator of satellite cell myogenesis, cause early onset myopathy, areflexia, respiratory distress and dysphagia (EMARDD) Telomere shortening alters the kinetics of the DNA damage response after ionizing radiation in human cells Tuberin and PRAS40 are anti-apoptotic gatekeepers during early human amniotic fluid stem-cell differentiation Excitation-induced ataxin-3 aggregation in neurons from patients with Machado–Joseph disease Wnt signaling and a Smad pathway blockade direct the differentiation of human pluripotent stem cells to multipotent neural crest cells Mesenchymal stem cell–based tissue regeneration is governed by recipient T lymphocytes via IFN-γ and TNF-α Neural correlates of reliability-based cue weighting during multisensory integration Combination epigenetic therapy has efficacy in patients with refractory advanced non–small cell lung cancer In vivo sustained release of siRNA from solid lipid nanoparticles Tracheobronchial transplantation with a stem-cell-seeded bioartificial nanocomposite: a proof-of-concept study UCP2 regulates energy metabolism and differentiation potential of human pluripotent stem cells Interleukin-2 and regulatory T cells in graft-versus-host disease Screening ethnically diverse human embryonic stem cells identifies a chromosome 20 minimal amplicon conferring growth advantage Rational bioprocess design for human pluripotent stem cell expansion and endoderm differentiation based on cellular dynamics Reversible cell-cycle entry in adult kidney podocytes through regulated control of telomerase and Wnt signaling Reprogramming factor stoichiometry influences the epigenetic state and biological properties of induced pluripotent stem cells New gene functions in megakaryopoiesis and platelet formation Antitumor activity from antigen-specific CD8 T cells generated in vivo from genetically engineered human hematopoietic stem cells Long noncoding RNA-mediated anti-apoptotic activity in murine erythroid terminal differentiation Prevalence of immune disease in patients with wounds presenting to a tertiary wound healing centre Erythroid/myeloid progenitors and hematopoietic stem cells originate from distinct populations of endothelial cells Genetic and epigenetic defects in DNA repair lead to synthetic lethality of poly (ADP-ribose) polymerase (PARP) inhibitors in aggressive myeloproliferative disorders Sirt1 mediates neuroprotection from mutant huntingtin by activation of the TORC1 and CREB transcriptional pathway Adoptive immunotherapy with autologous CD3/CD28-costimulated T-cells after fludarabine-based chemotherapy in patients with chronic lymphocytic leukemia Jamb and Jamc are essential for vertebrate myocyte fusion Biodegradable poly(amine-co-ester) terpolymers for targeted gene delivery A 2-step approach to myeloablative haploidentical stem cell transplantation: a phase 1/2 trial performed with optimized T-cell dosing Adipocyte lineage cells contribute to the skin stem cell niche to drive hair cycling Amyloid triggers extensive cerebral angiogenesis causing blood brain barrier permeability and hypervascularity in Alzheimer's Disease Optimizing the societal benefits of the annual influenza vaccine: a stochastic programming approach Muscle-derived stem/progenitor cell dysfunction limits healthspan and lifespan in a murine progeria model Adeno-associated virus type 2 infection activates caspase dependent and independent apoptosis in multiple breast cancer lines but not in normal mammary epithelial cells Lentivirus-mediated expression of cDNA and shRNA slows degeneration in retinitis pigmentosa CAD/CAM-assisted breast reconstruction Defective photoreceptor phagocytosis in a mouse model of enhanced S-cone syndrome causes progressive retinal degeneration Intravenous delivery of a multi-mechanistic cancer-targeted oncolytic poxvirus in humans lincRNAs act in the circuitry controlling pluripotency and differentiation Direct laser writing of 3D scaffolds for neural tissue engineering applications SUMO1-dependent modulation of SERCA2a in heart failure Axon regeneration pathways identified by systematic genetic screening in C. elegans The ALS-associated proteins FUS and TDP-43 function together to affect Drosophila locomotion and life span Inhibition of fatty acid metabolism ameliorates disease activity in an animal model of multiple sclerosis Pancreatic mesenchyme regulates epithelial organogenesis throughout development Isolation and in vitro expansion of human colonic stem cells ROCK and JAK1 signaling cooperate to control actomyosin contractility in tumor cells and stroma Mutational inactivation of STAG2 causes aneuploidy in human cancer Biochemical alterations associated with ALS Damage associated molecular patterns within xenogeneic biologic scaffolds and their effects on host remodeling Stem cell gene expression programs influence clinical outcome in human leukemia Spatially controlled simultaneous patterning of multiple growth factors in three-dimensional hydrogels Stochastic state transitions give rise to phenotypic equilibrium in populations of cancer cells Derivation of insulin producing cells from human endometrial stromal stem cells and use in the treatment of murine diabetes Conversion of mouse and human fibroblasts into functional spinal motor neurons Transplantation of human pericyte progenitor cells improves the repair of infarcted heart through activation of an angiogenic program involving micro-RNA-132 The lamina propria of adult human oral mucosa harbors a novel stem cell population Heterogeneity in SDF-1 expression defines the vasculogenic potential of adult cardiac progenitor cells CD8α+ dendritic cells are the critical source of interleukin-12 that controls acute infection by toxoplasma gondii tachyzoites CD8α+ dendritic cells are an obligate cellular entry point for productive infection by listeria monocytogenes ATP7A gene addition to the choroid plexus results in long-term rescue of the lethal copper transport defect in a menkes disease mouse model Multi-hierarchical self-assembly of a collagen mimetic peptide from triple helix to nanofibre and hydrogel SLC6A14 (ATB0,+) protein, a highly concentrative and broad specific amino acid transporter, is a novel and effective drug target for treatment of estrogen receptor-positive breast cancer Intravenous autologous bone marrow mononuclear cells for ischemic stroke Mutations in CIC and FUBP1 contribute to human oligodendroglioma Decreased zinc and downregulation of ZIP3 zinc uptake transporter in the development of pancreatic adenocarcinoma Risk assessment model for development of advanced age-related macular degeneration GeT peptides: a single-domain approach to gene delivery Overcoming hypoxia-induced apoptotic resistance through combinatorial inhibition of GSK-3β and CDK1 Fresh surgical specimens yield breast stem/progenitor cells and reveal their oncogenic abnormalities Successful implantation of bioengineered, intrinsically innervated, human internal anal sphincter Exome sequencing and analysis of induced pluripotent stem cells identify the cilia-related gene male germ cell-associated kinase (MAK) as a cause of retinitis pigmentosa Stimulating cardiac muscle by light RALA and RALBP1 regulate mitochondrial fission at mitosis LIM kinase 1 modulates cortical actin and CXCR4 cycling and is activated by HIV-1 to initiate viral infection Activation of human T-helper/inducer cell, T-cytotoxic cell, B-cell, and natural killer (NK)-cells and induction of natural killer cell activity against k562 chronic myeloid leukemia cells with modified citrus pectin Genome-wide association studies of adolescent idiopathic scoliosis suggest candidate susceptibility genes Frequent mutations of chromatin remodeling genes in transitional cell carcinoma of the bladder A resource of vectors and ES cells for targeted deletion of microRNAs in mice Notch post-translationally regulates β-catenin protein in stem and progenitor cells An antibody against SSEA-5 glycan on human pluripotent stem cells enables removal of teratoma-forming cells Lineage restricted progenitors for the repopulation of decellularized heart Revealing off-target cleavage specificities of zinc-finger nucleases by in vitro selection An unbiased genome-wide analysis of zinc-finger nuclease specificity Combination therapy utilizing shRNA knockdown and an optimized resistant transgene for rescue of diseases caused by misfolded proteins Mechanoregulation of vascularization in aligned tissue-engineered muscle: a role for vascular endothelial growth factor Phase IB study of gene-mediated cytotoxic immunotherapy adjuvant to up-front surgery and intensive timing radiation for malignant glioma Rb and p130 control cell cycle gene silencing to maintain the postmitotic phenotype in cardiac myocytes T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced leukemia Chimeric antigen receptor–modified T cells in chronic lymphoid leukemia Defining the nature of human pluripotent stem cell progeny Understanding the metabolic basis of drug resistance: Therapeutic induction of the Warburg effect kills cancer cells HIV-1 adaptation to NK-cell-mediated immune pressure Spider silk-based gene carriers for tumor cell-specific delivery Somatic oxidative bioenergetics transitions into pluripotency-dependent glycolysis to facilitate nuclear reprogramming Nonrandom attrition of the naive CD8+ T-cell pool with aging governed by T-cell receptor:pMHC interactions Engineered lentiviral vectors pseudotyped with a CD4 receptor and a fusogenic protein can target cells expressing HIV-1 envelope proteins Stem cell–mediated transfer of a human artificial chromosome ameliorates muscular dystrophy Visual data integration for imaging-based planning in human craniofacial transplantation Skin-resident murine dendritic cell subsets promote distinct and opposing antigen-specific T helper cell responses Efficient recombinase-mediated cassette exchange at the AAVS1 locus in human embryonic stem cells using baculoviral vectors Recurrent GNAS mutations define an unexpected pathway for pancreatic cyst development Radical acceleration of nuclear reprogramming by chromatin remodeling with the transactivation domain of MyoD Clustering and activity tuning of Kv1 channels in myelinated hippocampal Direct reprogramming of adult human fibroblasts to functional neurons under defined conditions Long-term outcome of patients with metastatic breast cancer treated with high-dose chemotherapy and transplantation of purified autologous hematopoietic stem cells Fgf differentially controls cross-antagonism between cardiac and haemangioblast regulators Impaired respiratory and body temperature control upon acute serotonergic neuron inhibition Bcl6 mediates the development of T follicular helper cells Follicular regulatory T cells expressing Foxp3 and Bcl-6 suppress germinal center reactions Exon skipping and dystrophin restoration in patients with Duchenne muscular dystrophy after systemic phosphorodiamidate morpholino oligomer treatment: an open-label, phase 2, dose-escalation study Brief report: efficient generation of hematopoietic precursors and progenitors from human pluripotent stem cell lines Genetic engineering of human pluripotent cells using TALE nucleases Generation of isogenic pluripotent stem cells differing exclusively at two early onset Parkinson point mutations Human neural stem cell transplantation ameliorates radiation-induced cognitive dysfunction Observations on the remarkable (and mysterious) wound-healing process of the bottlenose dolphin Proinvasion metastasis drivers in early-stage melanoma are oncogenes Progesterone inhibits the growth of human neuroblastoma: in vitro and in vivo evidence Nanoscale surfaces for the long-term maintenance of mesenchymal stem cell phenotype and multipotency High success rate of hematopoietic cell transplantation regardless of donor source in children with very high-risk leukemia Precise manipulation of chromosomes in vivo enables genome-wide codon replacement Epigenetic memory and preferential lineage-specific differentiation in induced pluripotent stem cells derived from human pancreatic islet beta cells The tumor suppressor Tsc1 enforces quiescence of naive T cells to promote immune homeostasis and function Functional regeneration of respiratory pathways after spinal cord injury MicroRNA-mediated conversion of human fibroblasts to neurons Cardiac AAV9-S100A1 gene therapy rescues post-ischemic heart failure in a preclinical large animal model Expression of apolipoprotein A-I in rabbit carotid endothelium protects against atherosclerosis Control of TH17 cells occurs in the small intestine Interaction between ERAP1 and HLA-B27 in ankylosing spondylitis implicates peptide handling in the mechanism for HLA-B27 in disease susceptibility Cardiac stem cells in patients with ischaemic cardiomyopathy (SCIPIO): initial results of a randomised phase 1 trial Foxp2 regulates gene networks implicated in neurite outgrowth in the developing brain Dehydro-α-lapachone, a plant product with antivascular activity Intramyocardial, autologous CD34+ cell therapy for refractory angina Chemotactic cell trapping in controlled alternating gradient fields Transcriptome transfer provides a model for understanding the phenotype of cardiomyocytes One-pot synthesis of microcapsules with nanoscale inclusions Prevention of murine autoimmune diabetes by CCL22-mediated Treg recruitment to the pancreatic islets A multicellular approach forms a significant amount of tissue-engineered small intestine in the mouse Purification of immature neuronal cells from neural stem cell progeny Non-viral gene delivery nanoparticles based on Poly(β-amino esters) for treatment of glioblastoma Novel stem/progenitor cell population from murine tracheal submucosal gland ducts with multipotent regenerative potential Embryonic stem cell bioprinting for uniform and controlled size embryoid body formation Temporal dissection of tumorigenesis in primary cancers Upregulation of adipogenesis and chondrogenesis in MSC serum-free culture Integrated genomic analyses of ovarian carcinoma Impaired thermosensation in mice lacking TRPV3, a heat and camphor sensor in the skin TRPV3 regulates nitric oxide synthase-independent nitric oxide synthesis in the skin Dosage thresholds for AAV2 and AAV8 photoreceptor gene therapy in monkey Functional motor recovery from brain ischemic insult by carbon nanotube-mediated siRNA silencing MiR-34a chemo-sensitizes bladder cancer cells to cisplatin treatment regardless of P53-Rb pathway status Loss of H3K4 methylation destabilizes gene expression patterns and physiological functions in adult murine Cardiomyocytes Micropatterned mammalian cells exhibit phenotype-specific left-right asymmetry DAXX/ATRX, MEN1, and mTOR pathway genes are frequently altered in pancreatic neuroendocrine tumors Altered telomeres in tumors with ATRX and DAXX mutations In vivo clonal analysis reveals self-renewing and multipotent adult neural stem cell characteristics Charcot-Marie-Tooth disease-associated mutant tRNA synthetases linked to altered dimer interface and neurite distribution defect Dispersed disease-causing neomorphic mutations on a single protein promote the same localized conformational opening On-demand controlled release of docetaxel from a battery-less MEMS drug delivery device Calcium upregulation by percutaneous administration of gene therapy in cardiac disease (CUPID) Multiple forms of activity-dependent competition refine hippocampal circuits in vivo Extracellular matrix powder protects against bleomycin-induced pulmonary fibrosis Identification and expansion of a unique stem cell population from adult mouse gallbladder Ultrasound elasticity imaging for detecting intestinal fibrosis and inflammation in rats and humans with Crohn's disease A synthetic optogenetic transcription device enhances blood-glucose homeostasis in mice Nanomaterials for X-ray imaging: gold nanoparticle enhancement of X-ray scatter imaging of hepatocellular carcinoma In vivo genome editing restores haemostasis in a mouse model of haemophilia Zfp488 promotes oligodendrocyte differentiation of neural progenitor cells in adult mice after demyelination Multimodal silica nanoparticles are effective cancer-targeted probes in a model of human melanoma Notch-dependent differentiation of adult airway basal stem cells Broad antigenic coverage induced by vaccination with virus-based cDNA libraries cures established tumors An analysis of high ferritin levels before allogeneic hematopoietic cell transplantation (AlloHCT): A retrospective study to evaluate prognostic factors in patients (pts) undergoing AlloHCT for myelodysplasia Nanoparticles that communicate in vivo to amplify tumour targeting Erythrocyte membrane-camouflaged polymeric nanoparticles as a biomimetic delivery platform Graded Nodal/Activin signaling titrates conversion of quantitative Phospho-Smad2 levels into qualitative embryonic stem cell fate decisions Artificially induced protein–membrane anchorage with cholesterol-based recognition agents as a new therapeutic concept Radioimmunotherapy with Lu-177 labeled anti-CAIX monoclonal antibody in advanced renal cell carcinoma Hedgehog overexpression is associated with stromal interactions and predicts for poor outcome in breast cancer Direct conversion of human fibroblasts to dopaminergic neurons Optic vesicle-like structures derived from human pluripotent stem cells facilitate a customized approach to retinal disease treatment Engineering biosynthetic excitable tissues from unexcitable cells for electrophysiological and cell therapy studies Basolateral amygdala regulation of adult hippocampal neurogenesis and fear-related activation of newborn neurons Evolutionary origin of a novel gene expression pattern through co-option of the latent activities of existing regulatory sequences First experience with a paracorporeal artificial lung in a small child with pulmonary hypertension Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy Downregulation of VAPB expression in motor neurons derived from induced pluripotent stem cells of ALS8 patients Engineered bivalent ligands to bias ErbB receptor-mediated signaling and phenotypes Loss of the miR-21 allele elevates the expression of its target genes and reduces tumorigenesis De novo cardiomyocytes from within the activated adult heart after injury RUNX3 acts as a tumor suppressor in breast cancer by targeting estrogen receptor α Antireflux surgery preserves lung function in patients with gastroesophageal reflux disease and end-stage lung disease before and after lung transplantation The impact of conversion from prograf to generic tacrolimus in liver and kidney transplant recipients with stable graft function A biochemical–biophysical study of hemoglobins from woolly mammoth, asian elephant, and humans An isoform of decorin is a resistin receptor on the surface of adipose progenitor cells Determinants of nucleosome organization in primary human cells A function for cyclin D1 in DNA repair uncovered by protein interactome analyses in human cancers The orphan disease networks α-catenin is a tumor suppressor that controls cell accumulation by regulating the localization and activity of the transcriptional coactivator Yap1 Kinome screening for regulators of the estrogen receptor identifies LMTK3 as a new therapeutic target in breast cancer Optic vesicle-like structures derived from human pluripotent stem cells facilitate a customized approach to retinal disease treatment E-cadherin is crucial for embryonic stem cell pluripotency and can replace OCT4 during somatic cell reprogramming Tumor-initiating stem cells of squamous cell carcinomas and their control by TGF-β and integrin/focal adhesion kinase (FAK) signaling Genomic comparison of multi-drug resistant invasive and colonizing Acinetobacter baumannii isolated from diverse human body sites reveals genomic plasticity Induction of human neuronal cells by defined transcription factors Democracy derived? New trajectories in pluripotent stem cell research Specification of transplantable astroglial subtypes from human pluripotent stem cells Paracrine and autocrine signals induce and maintain mesenchymal and stem cell states in the breast A low-dose insulin infusion suppresses the expression of β-amyloid precursor protein Post-progression treatment with APC8015F may have prolonged survival of subjects in the control arm of sipuleucel-T phase III studies Supercoiled Minivector DNA resists shear forces associated with gene therapy delivery Virus-induced tumor inflammation facilitates effective DC cancer immunotherapy in a Treg-dependent manner in mice Off-target lapatinib activity sensitizes colon cancer cells through TRAIL death receptor up-regulation gp100 peptide vaccine and interleukin-2 in patients with advanced melanoma Suppression of inflammatory and neuropathic pain by uncoupling CRMP-2 from the presynaptic Ca2+ channel complex The use of mesenchymal stem cells in orthopedics: review of the literature, current research, and regulatory landscape Functional crosstalk between Bmi1 and MLL/Hoxa9 axis in establishment of normal hematopoietic and leukemic stem cells Kinase inhibitors modulate huntingtin cell localization and toxicity Polyvalent nucleic acid nanostructures Association of lipidome remodeling in the adipocyte membrane with acquired obesity in humans Attenuation of HIV-associated human B cell exhaustion by siRNA downregulation of inhibitory receptors ABCB5 identifies a therapy-refractory tumor cell population in colorectal cancer patients Vaccination with patient-specific tumor-derived antigen in first remission improves disease-free survival in follicular lymphoma The cysteine protease inhibitor, E64d, reduces brain amyloid-β and improves memory deficits in Alzheimer's Disease animal models by inhibiting cathepsin B, but not BACE1, β-secretase activity Autocrine effects of mesenchymal stem cells expressing IGF-I rescue the fracture-healing defects of Irs1 knockout mice Microstructured templates for directed growth and vascularization of soft tissue in vivo A voltage-dependent channel involved in nutrient uptake by red blood cells infected with the malaria parasite Malaria parasite clag3 genes determine channel-mediated nutrient uptake by infected red blood cells Massive ex vivo expansion of human natural regulatory T cells (Tregs) with minimal loss of in vivo functional activity The JAK2/STAT3 signaling pathway is required for growth of CD44+CD24– stem cell–like breast cancer cells in human tumors Sorafenib enhances the antitumor effects of chemoradiation treatment by downregulating ERCC-1 and XRCC-1 DNA repair proteins Three-dimensional polymer constructs exhibiting a tunable negative poisson's ratio Poly(lactic–co-glycolic acid): Carbon nanofiber composites for myocardial tissue engineering applications Regulation of angiogenesis by a non-canonical Wnt–Flt1 pathway in myeloid cells Functional regulatory T cells produced by inhibiting cyclic nucleotide phosphodiesterase type 3 prevent allograft rejection Aberrant succination of proteins in fumarate hydratase-deficient mice and HLRCC patients is a robust biomarker of mutation status Targeted gene correction of laminopathy-associated LMNA mutations in patient-specific iPSCs Lrp5 functions in bone to regulate bone mass Human regulatory T cells with alloantigen specificity are more potent inhibitors of alloimmune skin graft damage than polyclonal regulatory T cells Simultaneous visualization of both signaling cascade activity and end-point gene expression in single cells Loss of the miR-21 allele elevates the expression of its target genes and reduces tumorigenesis Sensitization of head and neck cancer to cisplatin through the use of a novel curcumin analog Chromatin “prepattern” and histone modifiers in a fate choice for liver and pancreas Computational design of proteins targeting the conserved stem region of influenza hemagglutinin Hydrogen peroxide promotes injury-induced peripheral sensory axon regeneration in the zebrafish skin In vivo liver regeneration potential of human induced pluripotent stem cells from diverse origins Improving cutaneous scar formation by controlling the mechanical environment: large animal and phase I studies Collective cell guidance by cooperative intercellular forces Telomere shortening and loss of self-renewal in dyskeratosis congenita induced pluripotent stem cells Multiple recognition assay reveals prostasomes as promising plasma biomarkers for prostate cancer Complete budding and asymmetric division of primitive model cells to produce daughter vesicles with different interior and membrane compositions High-throughput analysis of single hematopoietic stem cell proliferation in microfluidic cell culture arrays BCL6 enables Ph+ acute lymphoblastic leukaemia cells to survive BCR–ABL1 kinase inhibition New adeno-associated virus strategies to support momentum in the clinic A simple method to increase the transduction efficiency of single-stranded adeno-associated virus vectors in vitro and in vivo Systemic elimination of de novo capsid protein synthesis from replication-competent AAV contamination in the liver A versatile adeno-associated virus vector producer cell line method for scalable vector production of different serotypes Mycophenolate mofetil impairs transduction of single-stranded adeno-associated viral vectors Good manufacturing practice production of self-complementary serotype 8 adeno-associated viral vector for a hemophilia B clinical trial Cancer screening by systemic administration of a gene delivery vector encoding tumor-selective secretable biomarker expression C20-D3-vitamin A slows lipofuscin accumulation and electrophysiological retinal degeneration in a mouse model of Stargardt disease Deuterium enrichment of vitamin A at the C20 position slows the formation of detrimental vitamin A dimers in wild-type rodents Genome-wide association and linkage identify modifier loci of lung disease severity in cystic fibrosis at 11p13 and 20q13.2 Tissue-engineered vascular grafts form neovessels that arise from regeneration of the adjacent blood vessel γδ intraepithelial lymphocytes are essential mediators of host–microbial homeostasis at the intestinal mucosal surface Object detection in the ring scotoma of a monocular bioptic telescope Celecoxib inhibits STAT3 phosphorylation and suppresses cell migration and colony forming ability in rhabdomyosarcoma cells Celecoxib inhibits Interleukin-6/Interleukin-6 receptor–induced JAK2/STAT3 phosphorylation in human hepatocellular carcinoma cells The Parkinsonian mimetic, MPP+, specifically impairs mitochondrial transport in dopamine axons Hierarchical self-assembly of amelogenin and the regulation of biomineralization at the nanoscale Defective regulation of autophagy upon leucine deprivation reveals a targetable liability of human melanoma cells in vitro and in vivo Apogossypol derivative BI-97C1 (Sabutoclax) targeting Mcl-1 sensitizes prostate cancer cells to mda-7/IL-24–mediated toxicity Induction of functional hepatocyte-like cells from mouse fibroblasts by defined factors Evidence for human lung stem cells Structurally distinct LewisX glycans distinguish subpopulations of neural stem/progenitor cells A hormone-dependent module regulating energy balance Class IIa histone deacetylases are hormone-activated regulators of FOXO and mammalian glucose homeostasis Clonogenic neoblasts are pluripotent adult stem cells that underlie planarian regeneration Profound early control of highly pathogenic SIV by an effector memory T-cell vaccine Immunogenicity of induced pluripotent stem cells Delayed intrathecal delivery of RhoA siRNA to the contused spinal cord inhibits allodynia, preserves white matter, and increases serotonergic fiber growth Transplantation of adult mouse iPS cell-derived photoreceptor precursors restores retinal structure and function in degenerative mice Carnitine palmitoyltransferase 1C promotes cell survival and tumor growth under conditions of metabolic stress Transmembrane semaphorin signalling controls laminar stratification in the mammalian retina A combinatorial semaphorin code instructs the initial steps of sensory circuit assembly in the Drosophila CNS Injectable fibroblast growth factor-2 coacervate for persistent angiogenesis A dynamic view of trauma/hemorrhage-induced inflammation in mice: principal drivers and networks Single-cell mass cytometry of differential immune and drug responses across a human hematopoietic continuum Division-coupled astrocytic differentiation and age-related depletion of neural stem cells in the adult hippocampus Human ESC-derived neural crest model reveals a key role for SOX2 in sensory neurogenesis In vivo protein trapping produces a functional expression codex of the vertebrate proteome CD4+CD25+CD127dimFoxp3+ T cells are cytotoxic for human neurons Novel CCL21-vault nanocapsule intratumoral delivery inhibits lung cancer growth Use of size and a copolymer design feature to improve the biodistribution and the enhanced permeability and retention effect of doxorubicin-loaded mesoporous silica nanoparticles in a murine xenograft tumor model Composite scaffold provides a cell delivery platform for cardiovascular repair Cdc42-interacting protein 4 is a Src substrate that regulates invadopodia and invasiveness of breast tumors by promoting MT1-MMP endocytosis Immune and genetic correlates of vaccine protection against mucosal infection by SIV in monkeys Transcription factor Foxp1 exerts essential cell-intrinsic regulation of the quiescence of naive T cells Therapeutic cell engineering with surface-conjugated synthetic nanoparticles Temperature-dependent STIM1 activation induces Ca2+ influx and modulates gene expression A rapid, extensive, and transient transcriptional response to estrogen signaling in breast cancer cells Rapid induction and long-term self-renewal of primitive neural precursors from human embryonic stem cells by small molecule inhibitors Direct reprogramming of mouse fibroblasts to neural progenitors A Drosophila model of FUS-related neurodegeneration reveals genetic interaction between FUS and TDP-43 The encephalitogenicity of TH17 cells is dependent on IL-1- and IL-23-induced production of the cytokine GM-CSF Pancreatic β cell identity is maintained by DNA methylation-mediated repression of Arx Layer-by-layer nanoparticles with a pH-sheddable layer for in vivo targeting of tumor hypoxia A model of threshold behavior reveals rescue mechanisms of bystander proteins in conformational diseases Alteration of the serine protease PRSS56 causes angle-closure glaucoma in mice and posterior microphthalmia in humans and mice Suppression of TH17 differentiation and autoimmunity by a synthetic ROR ligand Targeting of mannan-binding lectin-associated serine protease-2 confers protection from myocardial and gastrointestinal ischemia/reperfusion injury Human xeno-autoantibodies against a non-human sialic acid serve as novel serum biomarkers and immunotherapeutics in cancer Molecular targeting of CSN5 in human hepatocellular carcinoma: a mechanism of therapeutic response Rapid induction and long-term self-renewal of primitive neural precursors from human embryonic stem cells by small molecule inhibitors Polycystin-1 regulates STAT activity by a dual mechanism Drug discovery using chemical systems biology: weak inhibition of multiple kinases may contribute to the anti-cancer effect of Nelfinavir Intramyocardial, autologous CD34+ cell therapy for refractory angina Nitric oxide scavenging by red blood cell microparticles and cell-free hemoglobin as a mechanism for the red cell storage lesion Gastroesophageal reflux disease symptom severity, proton pump inhibitor use, and esophageal carcinogenesis CD28 costimulation improves expansion and persistence of chimeric antigen receptor–modified T cells in lymphoma patients Imipramine treatment improves cognitive outcome associated with enhanced hippocampal neurogenesis after traumatic brain injury in mice Combinatorial binding of transcription factors in the pluripotency control regions of the genome Engineering nanocarriers for siRNA delivery Vaults engineered for hydrophobic drug delivery Reelin, Rap1 and N-cadherin orient the migration of multipolar neurons in the developing neocortex Use of whole-genome sequencing to diagnose a cryptic fusion oncogene Identification of a novel TP53 cancer susceptibility mutation through whole-genome sequencing of a patient with therapy-related AML A non membrane-targeted human soluble CD59 attenuates choroidal neovascularization in a model of age related macular degeneration Oxidase-deficient neutrophils from X-linked chronic granulomatous disease iPS cells: functional correction by zinc finger nuclease–mediated safe harbor targeting Pharmacological characterization of chemically synthesized monomeric phi29 pRNA nanoparticles for systemic delivery Assembly of therapeutic pRNA-siRNA nanoparticles using bipartite approach The targeted delivery of multicomponent cargos to cancer cells by nanoporous particle-supported lipid bilayers A high-resolution C. elegans essential gene network based on phenotypic profiling of a complex tissue A kinase shRNA screen links LATS2 and the pRB tumor suppressor DYRK1A protein kinase promotes quiescence and senescence through DREAM complex assembly A new subtype of progenitor cell in the mouse embryonic neocortex PDGFRα-positive cells in bone marrow are mobilized by high mobility group box 1 (HMGB1) to regenerate injured epithelia Modelling schizophrenia using human induced pluripotent stem cells Cutting edge: humanized nano-proresolving medicines mimic inflammation-resolution and enhance wound healing Differentiation of induced pluripotent stem cells of swine into rod photoreceptors and their integration into the retina Gene therapy for pain: Results of a phase I clinical trial A rapid and scalable system for studying gene function in mice using conditional RNA interference Reversible suppression of an essential gene in adult mice using transgenic RNA interference ApoE isoform-specific regulation of regeneration in the peripheral nervous system Polycomb EZH2 controls self-renewal and safeguards the transcriptional identity of skeletal muscle stem cells Mice with behavioral evidence of tinnitus exhibit dorsal cochlear nucleus hyperactivity because of decreased GABAergic inhibition Human flap endonuclease structures, DNA double-base flipping, and a unified understanding of the FEN1 superfamily Genetic correction and analysis of induced pluripotent stem cells from a patient with gyrate atrophy Preclinical screening of anti-HER2 nanobodies for molecular imaging of breast cancer Fibroblast growth factor 9 delivery during angiogenesis produces durable, vasoresponsive microvessels wrapped by smooth muscle cells IL-2 induces a WAVE2-dependent pathway for actin reorganization that enables WASp-independent human NK cell function Control of pancreatic β cell regeneration by glucose metabolism A universal system for highly efficient cardiac differentiation of human induced pluripotent stem cells that eliminates interline variability Microbial electricity generation via microfluidic flow control Esophageal preservation in five male patients after endoscopic inner-layer circumferential resection in the setting of superficial cancer: a regenerative medicine approach with a biologic scaffold Virally delivered channelrhodopsin-2 safely and effectively restores visual function in multiple mouse models of blindness Nanofibrous hollow microspheres self-assembled from star-shaped polymers as injectable cell carriers for knee repair Engineering a waste management enzyme to overcome cancer resistance to apoptosis: adding DNase1 to the anti-cancer toolbox Chronic ulcerative stomatitis: evidence of autoimmune pathogenesis Bone marrow-derived cell therapy stimulates endogenous cardiomyocyte progenitors and promotes cardiac repair Quantification of the forces driving self-assembly of three-dimensional microtissues Polymalic acid–based nanobiopolymer provides efficient systemic breast cancer treatment by inhibiting both HER2/neu receptor synthesis and activity Highly efficient miRNA-mediated reprogramming of mouse and human somatic cells to pluripotency Modified Tat peptide with cationic lipids enhances gene transfection efficiency via temperature-dependent and caveolae-mediated endocytosis Genome-wide association study identifies a common variant associated with risk of endometrial cancer Prostaglandin E2 enhances human cord blood stem cell xenotransplants and shows long-term safety in preclinical nonhuman primate transplant models Self-organizing optic-cup morphogenesis in three-dimensional culture Normal and neoplastic nonstem cells can spontaneously convert to a stem-like state Generation of bioengineered corneas with decellularized xenografts and human keratocytes Control of copper resistance and inorganic sulfur metabolism by paralogous regulators in Staphylococcus aureus Dynamic regulation of 5-hydroxymethylcytosine in mouse ES cells and during differentiation A nanomechanical interface to rapid single-molecule interactions A diverse range of gene products are effectors of the type I interferon antiviral response Human induced pluripotent stem-derived retinal pigment epithelium (RPE) cells exhibit ion transport, membrane potential, polarized vascular endothelial growth factor secretion, and gene expression pattern similar to native RPE In vivo systems analysis identifies spatial and temporal aspects of the modulation of TNF-α–induced apoptosis and proliferation by MAPKs A randomized trial of the effect of patient race on physicians' intensive care unit and life-sustaining treatment decisions for an acutely unstable elder with end-stage cancer Characterization of KRAS rearrangements in metastatic prostate cancer Mutations in the RNA granule component TDRD7 cause cataract and glaucoma Eya1 controls cell polarity, spindle orientation, cell fate and Notch signaling in distal embryonic lung epithelium Multipotent progenitor cells derived from adult peripheral blood of swine have high neurogenic potential in vitro Noise contributions in an inducible genetic switch: a whole-cell simulation study Ciliary neurotrophic factor delivered by encapsulated cell intraocular implants for treatment of geographic atrophy in age-related macular degeneration Vitamin D status and early age-related macular degeneration in postmenopausal women Efficacy of periodontal stem cell transplantation in the treatment of advanced periodontitis Targeted delivery of small interfering RNA using rHDL nanoparticles SKIP counteracts p53-mediated apoptosis via selective regulation of p21Cip1 mRNA splicing Genome-wide analysis of 5-hydroxymethylcytosine distribution reveals its dual function in transcriptional regulation in mouse embryonic stem cells Dual functions of Tet1 in transcriptional regulation in mouse embryonic stem cells Circadian rhythm gene period 3 is an inhibitor of the adipocyte cell fate A long noncoding RNA maintains active chromatin to coordinate homeotic gene expression Identification of novel and distinct binding sites within tenascin-c for soluble and fibrillar fibronectin Therapeutic targeting of SPINK1-positive prostate cancer Rapid modulation of local neural activity by controlled drug release from polymer-coated recording microelectrodes Dominant prion mutants induce curing through pathways that promote chaperone-mediated disaggregation A neurodegenerative disease mutation that accelerates the clearance of apoptotic cells Catecholamine receptor polymorphisms affect decision-making in C. elegans Sirolimus for angiomyolipoma in tuberous sclerosis complex or lymphangioleiomyomatosis Efficacy and safety of sirolimus in lymphangioleiomyomatosis The complexity hypothesis revisited: connectivity rather than function constitutes a barrier to horizontal gene transfer High-resolution Fourier-transform infrared chemical imaging with multiple synchrotron beams Modulation of metabolic brain networks after subthalamic gene therapy for Parkinson's disease Safety and tolerability of gene therapy with an adeno-associated virus (AAV) borne GAD gene for Parkinson's disease: an open label, phase I trial Subthalamic GAD gene therapy in a Parkinson's disease rat model Long-term gene expression and phenotypic correction using adeno-associated virus vectors in the mammalian brain AAV2-GAD gene therapy for advanced Parkinson's disease: a double-blind, sham-surgery controlled, randomised trial Integration-free induced pluripotent stem cells derived from schizophrenia patients with a DISC1 mutation Pancreatic cancers require autophagy for tumor growth Drosophila katanin is a microtubule depolymerase that regulates cortical-microtubule plus-end interactions and cell migration Myocardial infarction and cerebrovascular accident in patients with retinal vein occlusion Evidence for partial epithelial-to-mesenchymal transition (pEMT) and recruitment of motile blastoderm edge cells during avian epiboly Recapitulation of premature ageing with iPSCs from Hutchinson–Gilford progeria syndrome Rescue of lethal hepatic failure by hepatized lymph nodes in mice Parallel high-throughput RNA interference screens identify PINK1 as a potential therapeutic target for the treatment of DNA mismatch repair–deficient cancers Predicting cytotoxic T-cell age from multivariate analysis of static and dynamic biomarkers Immunotherapy with tolerogenic apolipoprotein B-100–loaded dendritic cells attenuates atherosclerosis in hypercholesterolemic mice Yap1 acts downstream of α-catenin to control epidermal proliferation Using self-assembled nanomaterials to inhibit the formation of metastatic cancer stem cell colonies in vitro Tissue-engineered autologous urethras for patients who need reconstruction: an observational study Short-term immunosuppression promotes engraftment of embryonic and induced pluripotent stem cells Single cell transcriptional profiling reveals heterogeneity of human induced pluripotent stem cells Uncovering the behaviors of individual cells within a multicellular microvascular community Evaluation of a multi-functional nanocarrier for targeted breast cancer iNOS gene therapy The treatment of neurodegenerative disorders using umbilical cord blood and menstrual blood-derived stem cells A high-throughput label-free nanoparticle analyser The cerebrospinal fluid provides a proliferative niche for neural progenitor cells LRRK2 mutant iPSC-derived DA neurons demonstrate increased susceptibility to oxidative stress A meningococcal factor H binding protein mutant that eliminates factor H binding enhances protective antibody responses to vaccination Wnt1 is a proangiogenic molecule, enhances human endothelial progenitor function, and increases blood flow to ischemic limbs in a HGF-dependent manner The controlled generation of functional basal forebrain cholinergic neurons from human embryonic stem cells Copy number variation and selection during reprogramming to pluripotency Materials for multifunctional balloon catheters with capabilities in cardiac electrophysiological mapping and ablation therapy Rapid three-dimensional isotropic imaging of living cells using Bessel beam plane illumination Self-renewal induced efficiently, safely, and effective therapeutically with one regulatable gene in a human somatic progenitor cell Mutations in NOTCH2 cause Hajdu-Cheney syndrome, a disorder of severe and progressive bone loss Transplantation of specific human astrocytes promotes functional recovery after spinal cord injury Astrocyte-neuron lactate transport is required for long-term memory formation NKp46 identifies an NKT cell subset susceptible to leukemic transformation in mouse and human Designed reduction of Streptococcus pneumoniae pathogenicity via synthetic changes in virulence factor codon-pair bias Parkin mediates beclin-dependent autophagic clearance of defective mitochondria and ubiquitinated Aβ in AD models Progressive regional atrophy in normal adults with a maternal history of Alzheimer disease Binge alcohol drinking is associated with GABAA α2-regulated Toll-like receptor 4 (TLR4) expression in the central amygdale Coupling of V(D)J recombination to the cell cycle suppresses genomic instability and lymphoid tumorigenesis Activated Ras requires autophagy to maintain oxidative metabolism and tumorigenesis MEK-ERK pathway modulation ameliorates disease phenotypes in a mouse model of Noonan syndrome associated with the Raf1L613V mutation Recombinant human CD19-ligand protein as a potent anti-leukaemic agent Microscale 3-D hydrogel scaffold for biomimetic gastrointestinal (GI) tract model Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1 Autografting of renal progenitor cells ameliorates kidney damage in experimental model of pyelonephritis Predicting clonal self-renewal and extinction of hematopoietic stem cells Interbilayer-crosslinked multilamellar vesicles as synthetic vaccines for potent humoral and cellular immune responses Retinoid-independent motor neurogenesis from human embryonic stem cells reveals a medial columnar ground state Transient regenerative potential of the neonatal mouse heart Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer Tumour microvesicles contain retrotransposon elements and amplified oncogene sequences Autologous bone marrow mononuclear cell therapy for severe traumatic brain injury in children RNA aptamer against a cancer stem cell marker epithelial cell adhesion molecule Human cord blood-derived endothelial progenitor cells and their conditioned media exhibit therapeutic equivalence for diabetic wound healing Glass-like dynamics of collective cell migration Outcomes after minimally invasive esophagectomy Small molecule inhibitors of Staphylococcus aureus RnpA alter cellular mRNA turnover, exhibit antimicrobial activity, and attenuate pathogenesis Co-adjuvant effects of retinoic acid and IL-15 induce inflammatory immunity to dietary antigens Synaptic potentiation onto habenula neurons in the learned helplessness model of depression Detection of circulating tumor cells in human peripheral blood using surface-enhanced raman scattering nanoparticles IL-7 engages multiple mechanisms to overcome chronic viral infection and limit organ pathology Induced pluripotent stem cell lines derived from equine fibroblasts DICER1 deficit induces Alu RNA toxicity in age-related macular degeneration Tregs prevent GvHD and promote immune reconstitution in HLA-haploidentical transplantation Functional effects of adult human olfactory stem cells on early-onset sensorineural hearing loss UBE4B promotes Hdm2-mediated degradation of the tumor suppressor p53 The stilbenoid tyrosine kinase inhibitor, G6, suppresses Jak2-V617F-mediated human pathological cell growth in vitro and in vivo β-catenin enhances Oct-4 activity and reinforces pluripotency through a TCF-independent mechanism 9p21 DNA variants associated with coronary artery disease impair interferon-γ signalling response Using induced pluripotent stem cells to investigate cardiac phenotypes in Timothy syndrome The glmS riboswitch integrates signals from activating and inhibitory metabolites in vivo ERG dependence distinguishes developmental control of hematopoietic stem cell maintenance from hematopoietic specification 5-lipoxygenase metabolite 4-HDHA is a mediator of the antiangiogenic effect of ω-3 polyunsaturated fatty acids Epicatechin blocks pro-nerve growth factor (proNGF)-mediated retinal neurodegeneration via inhibition of p75 neurotrophin receptor proNGF expression in a rat model of diabetes Diabetes-induced peroxynitrite impairs the balance of pro-nerve growth factor and nerve growth factor, and causes neurovascular injury Low prevalence of "ideal cardiovascular health" in a community-based population Mapping of the disease locus and identification of ADAMTS10 as a candidate gene in a canine model of primary open angle glaucoma Translocation of the cytoplasmic domain of ADAM13 to the nucleus is essential for Calpain8-a expression and cranial neural crest cell migration CDK1-dependent phosphorylation of EZH2 suppresses methylation of H3K27 and promotes osteogenic differentiation of human mesenchymal stem cells EZH2 promotes expansion of breast tumor initiating cells through activation of RAF1-β-catenin signaling Golden Goal collaborates with Flamingo in conferring synaptic-layer specificity in the visual system Genomic instability in induced stem cells Access to stem cells and data: persons, property rights, and scientific progress Wounding mobilizes hair follicle stem cells to form tumors Oral delivery of RNase P ribozymes by Salmonella inhibits viral infection in mice Regulation of induced colonic inflammation by Lactobacillus acidophilus deficient in lipoteichoic acid Disruption of Src function potentiates Chk1-inhibitor–induced apoptosis in human multiple myeloma cells in vitro and in vivo Mitochondrial reactive oxygen species promote production of proinflammatory cytokines and are elevated in TNFR1-associated periodic syndrome (TRAPS) Paternal MHC expression on mouse trophoblast affects uterine vascularization and fetal growth Hotspots of aberrant epigenomic reprogramming in human induced pluripotent stem cells Time-reversed ultrasonically encoded optical focusing into scattering media Small RNA-mediated regulation of iPS cell generation Identification of adult nephron progenitors capable of kidney regeneration in zebrafish NT5E mutations and arterial calcifications ΔNp63α is an oncogene that targets chromatin remodeler Lsh to drive skin stem cell proliferation and tumorigenesis Efficient human iPS cell derivation by a non-integrating plasmid from blood cells with unique epigenetic and gene expression signatures Cancer tumors as Metazoa 1.0: tapping genes of ancient ancestors Redox regulation by Keap1 and Nrf2 controls intestinal stem cell proliferation in Drosophila Efficient generation of transgene-free induced pluripotent stem cells from normal and neoplastic bone marrow and cord blood mononuclear cells A functionally characterized test set of human induced pluripotent stem cells Reference maps of human ES and iPS cell variation enable high-throughput characterization of pluripotent cell lines Self-assembling elastin-like peptides growth factor chimeric nanoparticles for the treatment of chronic wounds Conversion of mouse fibroblasts into cardiomyocytes using a direct reprogramming strategy Creating higher titer lentivirus with caffeine Fabrication of stable and RNase-resistant RNA nanoparticles active in gearing the nanomotors for viral DNA packaging Tumor regression in patients with metastatic synovial cell sarcoma and melanoma using genetically engineered lymphocytes reactive with NY-ESO-1 Acquisition of HIV-1 resistance in T lymphocytes using an ACA-specific E. coli mRNA interferase Erythropoietin contrastingly affects bacterial infection and experimental colitis by inhibiting nuclear Factor-κB-inducible immune pathways Hydrophilic agarose macrobead cultures select for outgrowth of carcinoma cell populations that can restrict tumor growth Three-dimensional culture of mouse renal carcinoma cells in agarose macrobeads selects for a subpopulation of cells with cancer stem cell or cancer progenitor properties DICER1 deficit induces Alu RNA toxicity in age-related macular degeneration Cell infiltration and growth in a low density, uncompressed three-dimensional electrospun nanofibrous scaffold An optimized small molecule inhibitor cocktail supports long-term maintenance of human embryonic stem cells Notch1 loss of heterozygosity causes vascular tumors and lethal hemorrhage in mice Thermodynamic additivity of sequence variations: an algorithm for creating high affinity peptides without large libraries or structural information Exploring antibody recognition of sequence space through random-sequence peptide microarrays A human iPSC model of Hutchinson Gilford Progeria reveals vascular smooth muscle and mesenchymal stem cell defects Dentin matrix protein 1 induces membrane expression of VE-cadherin on endothelial cells and inhibits VEGF-induced angiogenesis by blocking VEGFR-2 phosphorylation Readily available tissue-engineered vascular grafts Selective targeting of activating and inhibitory Smads by distinct WWP2 ubiquitin ligase isoforms differentially modulates TGFβ signalling and EMT Characterization and functionality of cardiac progenitor cells in congenital heart patients Oncometabolite 2-hydroxyglutarate is a competitive inhibitor of α-ketoglutarate-dependent dioxygenases Role of parallel reformable bonds in the self-healing of cross-linked nanogel particles In vivo anomalous diffusion and weak ergodicity breaking of lipid granules Breast on-a-chip: mimicry of the channeling system of the breast for development of theranostics Targeted removal of migratory tumor cells by functionalized magnetic nanoparticles impedes metastasis and tumor progression Breast cancer stem cells are regulated by mesenchymal stem cells through cytokine networks The dual impact of HIV-1 infection and aging on naïve CD4+ T-cells: additive and distinct patterns of impairment Identification of adult nephron progenitors capable of kidney regeneration in zebrafish Evidence for an inherited predisposition to lumbar disc disease Maternal T cells limit engraftment after in utero hematopoietic cell transplantation in mice Nascent transcript sequencing visualizes transcription at nucleotide resolution Heat shock protein 27 differentiates tolerogenic macrophages that may support human breast cancer progression Staphylococcus aureus phenotype switching: an effective bacterial strategy to escape host immune response and establish a chronic infection Stromal endothelial cells directly influence cancer progression Multipotent adult progenitor cells prevent macrophage-mediated axonal dieback and promote regrowth after spinal cord injury Nestin negatively regulates postsynaptic differentiation of the neuromuscular synapse Cellular and extracellular programming of cell fate through engineered intracrine-, paracrine-, and endocrine-like mechanisms Mechanical properties and in vivo behavior of a biodegradable synthetic polymer microfiber-extracellular matrix hydrogel biohybrid scaffold A phase I study of concurrent chemotherapy (paclitaxel and carboplatin) and thoracic radiotherapy with swallowed manganese superoxide dismutase plasmid liposome protection in patients with locally advanced stage III non-small-cell lung cancer Generation of induced pluripotent stem cell lines from Friedreich Ataxia patients Cell therapy, a new standard in management of chronic critical limb ischemia and foot ulcer Modelling the long QT syndrome with induced pluripotent stem cells Treatment of acute otitis media in children under 2 years of age Detection of heteroplasmic mitochondrial DNA in single mitochondria Protein nanodisk assembling and intracellular trafficking powered by an arginine-rich (R9) peptide Internalization and kinetics of nuclear migration of protein-only, arginine-rich nanoparticles A transgenic mouse for in vivo detection of endogenous labeled mRNA Strain-resolved community genomic analysis of gut microbial colonization in a premature infant Increased expression and activity of 12-lipoxygenase in oxygen-induced ischemic retinopathy and proliferative diabetic retinopathy Covalently immobilized platelet-derived growth factor-BB promotes angiogenesis in biomimetic poly(ethylene glycol) hydrogels miR-29b is activated during neuronal maturation and targets BH3-only genes to restrict apoptosis Dexamethasone intravitreal implant for noninfectious intermediate or posterior uveitis Identification of molecular-mimicry-based ligands for cholera diagnostics using magnetic relaxation The microRNA miR-34a inhibits prostate cancer stem cells and metastasis by directly repressing CD44 Using mechanobiological mimicry of red blood cells to extend circulation times of hydrogel microparticles Regulation of E2Fs and senescence by PML nuclear bodies Dynamics between stem cells, niche, and progeny in the hair follicle Transdifferentiation of glioblastoma cells into vascular endothelial cells An optimized small molecule inhibitor cocktail supports long-term maintenance of human embryonic stem cells Determination of somatic and cancer stem cell self-renewing symmetric division rate using sphere assays Stromal endothelial cells directly influence cancer progression A human iPSC model of Hutchinson Gilford Progeria reveals vascular smooth muscle and mesenchymal stem cell defects ROCK inhibition facilitates the generation of human-induced pluripotent stem cells in a defined, feeder-, and serum-free system Functional mesenchymal stem cells derived from human induced pluripotent stem cells attenuate limb ischemia in mice Maximizing the efficiency of the U.S. liver allocation system through region design Flexural characterization of cell encapsulated PEGDA hydrogels with applications for tissue engineered heart valves De novo designed proteins from a library of artificial sequences function in Escherichia coli and enable cell growth Regulator of calcineurin 1 (RCAN1) facilitates neuronal apoptosis through caspase 3 activation Prefoldin 5 is required for normal sensory and neuronal development in a murine model The Notch target Hes1 directly modulates Gli1 expression and Hedgehog signaling: a potential mechanism of therapeutic resistance Platelets generated from human embryonic stem cells are functional in vitro and in the microcirculation of living mice Characteristics of the earliest cross-neutralizing antibody response to HIV-1 IRF5 promotes inflammatory macrophage polarization and T(H)1-T(H)17 responses Aberrant overexpression of satellite repeats in pancreatic and other epithelial cancers Tunable signal processing in synthetic MAP kinase cascades Dynamic changes in the copy number of pluripotency and cell proliferation genes in human ESCs and iPSCs during reprogramming and time in culture Bald scalp in men with androgenetic alopecia retains hair follicle stem cells but lacks CD200-rich and CD34-positive hair follicle progenitor cells Proliferative neural stem cells have high endogenous ROS levels that regulate self-renewal and neurogenesis in a PI3K/Akt-dependant manner Gene therapy by allele selection in a mouse model of beta-thalassemia Robo4 cooperates with Cxcr4 to specify hematopoietic stem cell localization to bone marrow niches Active scaffolds for on-demand drug and cell delivery Broadly cross-reactive antibodies dominate the human B cell response against 2009 pandemic H1N1 influenza virus infection Angiotensin-(1-7) reduces fibrosis in orthotopic breast tumors Non-stem cell origin for oligodendroglioma CDK1-dependent phosphorylation of EZH2 suppresses methylation of H3K27 and promotes osteogenic differentiation of human mesenchymal stem cells Massive genomic rearrangement acquired in a single catastrophic event during cancer development Loss-of-function mutations in the glutamate transporter SLC1A1 cause human dicarboxylic aminoaciduria Enhancing mda-7/IL-24 therapy in renal carcinoma cells by inhibiting multiple protective signaling pathways using sorafenib and by Ad.5/3 gene delivery Adipose-derived stem cells differentiate to keratocytes in vitro Transient regenerative potential of the neonatal mouse heart IOC consensus paper on the use of platelet-rich plasma in sports medicine Generation of viable male and female mice from two fathers Transcription of functionally related constitutive genes is not coordinated Retinoid X receptor gamma signaling accelerates CNS remyelination Multifunctional carbon-nanotube cellular endoscopes TRIM24 links a non-canonical histone signature to breast cancer Abl kinases are required for invadopodia formation and chemokine-induced invasion Quantifying the biophysical characteristics of Plasmodium-falciparum-parasitized red blood cells in microcirculation Podocyte-secreted angiopoietin-like-4 mediates proteinuria in glucocorticoid-sensitive nephrotic syndrome Genome-wide association study identifies a locus at 7p15.2 associated with endometriosis Short telomeres and stem cell exhaustion model Duchenne Muscular Dystrophy in mdx/mTR mice Fetal and adult hematopoietic stem cells give rise to distinct T cell lineages in humans The dynamic distribution of CARD11 at the immunological synapse is regulated by the inhibitory kinesin GAKIN Epigenetic suppression of the TGF-beta pathway revealed by transcriptome profiling in ovarian cancer Repression of the miR-143/145 cluster by oncogenic Ras initiates a tumor-promoting feed-forward pathway Acquired resistance to BRAF inhibitors mediated by a RAF kinase switch in melanoma can be overcome by cotargeting MEK and IGF-1R/PI3K β-catenin mediates the establishment and drug resistance of MLL leukemic stem cells Multifunctional carbon-nanotube cellular endoscopes Degradable polyester scaffolds with controlled surface chemistry combining minimal protein adsorption with specific bioactivation Phosphorylation of ULK1 (hATG1) by AMP-activated protein kinase connects energy sensing to mitophagy Ectopic expression of germline genes drives malignant brain tumor growth in Drosophila Association of a leukemic stem cell gene expression signature with clinical outcomes in acute myeloid leukemia Tumor-specific imaging through progression elevated gene-3 promoter-driven gene expression Substantial expression of mature elastin in arterial constructs Effective suppression of vascular network formation by combination of antibodies blocking VEGFR ligand binding and receptor dimerization Astrocyte elevated gene-1 induces protective autophagy Directed differentiation of human pluripotent stem cells into intestinal tissue in vitro MicroRNA profiling reveals two distinct p53-related human pluripotent stem cell states Reprogramming of human primary somatic cells by OCT4 and chemical compounds Regulation of hematopoietic stem cells by their mature progeny Bioactive peptides derived from vascular endothelial cell extracellular matrices promote microvascular morphogenesis and wound healing in vitro Mycobacterium tuberculosis evades host immunity by recruiting mesenchymal stem cells Sharing pathogenetic mechanisms between acute myocardial infarction and Alzheimer's disease as shown by partially overlapping of gene variant profiles Invasive three-dimensional organotypic neoplasia from multiple normal human epithelia Subdivisions of primary motor cortex based on cortico-motoneuronal cells The basal ganglia communicate with the cerebellum Maintenance treatment of depression in old age: A randomized, double-blind, placebo-controlled evaluation of the efficacy and safety of donepezil combined with antidepressant pharmacotherapy Periodic incorporation of pendant hydroxyl groups in repeating sequence PLGA copolymers Results following gamma knife radiosurgical anterior capsulotomies for obsessive compulsive disorder Repeatable photoinduced self-healing of covalently cross-linked polymers through reshuffling of trithiocarbonate units Epigenetic suppression of the TGF-beta pathway revealed by transcriptome profiling in ovarian cancer Fibrin microthreads support mesenchymal stem cell growth while maintaining differentiation potential Subtypes of medulloblastoma have distinct developmental origins MicroRNA miR-125b causes leukemia Bmi-1 Is a crucial regulator of prostate stem cell self-renewal and malignant transformation Ultraviolet B irradiation and activation of protein kinase D in primary mouse epidermal keratinocytes Brachyury establishes the embryonic mesodermal progenitor niche Mre11–Rad50–Xrs2 and Sae2 promote 5′ strand resection of DNA double-strand breaks COT drives resistance to RAF inhibition through MAP kinase pathway reactivation Estrogen expands breast cancer stem-like cells through paracrine FGF/Tbx3 signaling L1 retrotransposition in neurons is modulated by MeCP2 Rewiring of genetic networks in response to DNA damage Shotgun glycomics: a microarray strategy for functional glycomics Hybrid pore formation by directed insertion of α-haemolysin into solid-state nanopores Long-distance axon regeneration in the mature optic nerve: Contributions of oncomodulin, cAMP, and pten gene deletion Small-molecule inhibition of Wnt signaling through activation of casein kinase 1α miR-200 family and targets, ZEB1 and ZEB2, modulate uterine quiescence and contractility during pregnancy and labor Stage-specific sensitivity to p53 restoration during lung cancer progression Telomerase reactivation reverses tissue degeneration in aged telomerase-deficient mice Malignant cells facilitate lung metastasis by bringing their own soil The role of interleukin-1 in wound biology. Part II: In vivo and human translational studies The role of interleukin-1 in wound biology. Part I: Murine in silico and in vitro experimental analysis A non-human primate model for urinary bladder regeneration utilizing autologous sources of bone marrow derived mesenchymal stem cells Siah regulation of Pard3A controls neuronal cell adhesion during germinal zone exit Dynamic electromechanical hydrogel matrices for stem cell culture Interplay between the transcription factor Zif and aPKC regulates neuroblast polarity and self-renewal Tension directly stabilizes reconstituted kinetochore-microtubule attachments Overexpression of Fto leads to increased food intake and results in obesity Reversing EphB2 depletion rescues cognitive functions in Alzheimer model Three-dimensional cellular ultrastructure resolved by X-ray microscopy Complement factor H and age-related macular degeneration: the role of glycosaminoglycan recognition in disease pathology Impaired binding of the age-related macular degeneration-associated complement factor H 402H allotype to Bruch's Membrane in human retina Anti-acrolein treatment improves behavioral outcome and alleviates myelin damage in experimental autoimmune encephalomyelitis mouse Conversion of vascular endothelial cells into multipotent stem-like cells Nonsense mutations in FAM161A cause RP28-associated recessive retinitis pigmentosa CRX ChIP-seq reveals the cis-regulatory architecture of mouse photoreceptors Transplantation of mouse HSCs genetically modified to express a CD4-restricted TCR results in long-term immunity that destroys tumors and initiates spontaneous autoimmunity Monoclonal antibody targeting of N-cadherin inhibits prostate cancer growth, metastasis and castration resistance Stem-cell gene therapy for the Wiskott-Aldrich syndrome A model for neural development and treatment of Rett Syndrome using human induced pluripotent stem cells A defined glycosaminoglycan-binding substratum for human pluripotent stem cells Frequent mutation of BAP1 in metastasizing uveal melanomas A quality risk management model approach for cell therapy manufacturing Development of a Bacillus subtilis-based rotavirus vaccine Efficacy, heat stability and safety of intranasally administered Bacillus subtilis spore or vegetative cell vaccines expressing tetanus toxin fragment C Induction of human epithelial stem/progenitor expansion by FOXM1 DNMT3A mutations in acute myeloid leukemia Measurement of adherent cell mass and growth Physiological and pathological population dynamics of circulating human red blood cells The use of whole organ decellularization for the generation of a vascularized liver organoid Prevention of muscle aging by myofiber-associated satellite cell transplantation Visual activity regulates neural progenitor cells in developing Xenopus CNS through Musashi1 Neural crest origin of olfactory ensheathing glia Identifying single bases in a DNA oligomer with electron tunneling A model for neural development and treatment of Rett syndrome using human induced pluripotent stem cells Inductive angiocrine signals from sinusoidal endothelium are required for liver regeneration Angiocrine factors from Akt-activated endothelial cells balance self-renewal and differentiation of haematopoietic stem cells Stem-cell gene therapy for the Wiskott-Aldrich syndrome Therapeutic potential of human umbilical cord mesenchymal stem cells in the treatment of rheumatoid arthritis Conditional outlier detection for clinical alerting The emerging relationship between regenerative medicine and physical therapeutics Chemoprevention by nonsteroidal anti-inflammatory drugs eliminates oncogenic intestinal stem cells via SMAC-dependent apoptosis Stem cell dynamics in response to nutrient availability Small molecule inhibition of phosphatidylinositol-3,4,5-triphosphate (PIP3) binding to pleckstrin homology domains BCL6 repression of EP300 in human diffuse large B cell lymphoma cells provides a basis for rational combinatorial therapy The major genetic determinants of HIV-1 control affect HLA class I peptide presentation Suppression of antitumor immunity by stromal cells expressing fibroblast activation protein-alpha A genome-wide association study of Hodgkin's lymphoma identifies new susceptibility loci at 2p16.1 (REL), 8q24.21 and 10p14 (GATA3) Anaplastic lymphoma kinase inhibition in non–small-cell lung cancer Effect of a lung protective strategy for organ donors on eligibility and availability of lungs for transplantation: a randomized controlled trial Estimated supply of organ donors after circulatory determination of death: a population-based cohort study Improving the supply of donor organs: being careful with the gift of life Insulin-like growth factor receptor 1(IGFIR) is overexpressed in a subset of triple negative breast cancers Human anti–HIV-neutralizing antibodies frequently target a conserved epitope essential for viral fitness Polyreactivity increases the apparent affinity of anti-HIV antibodies by heteroligation Organotypic 3D cell culture models: using the rotating wall vessel to study host–pathogen interactions Phosphodiesterase 11A (PDE11A) genetic variants may increase susceptibility to prostatic cancer Clonal tracking of hESCs reveals differential contribution to functional assays Directed differentiation of human embryonic stem cells toward chondrocytes A genome-wide study reveals copy number variants exclusive to childhood obesity cases A reductionist cell-free major histocompatibility complex class II antigen processing system identifies immunodominant epitopes The structural basis for membrane binding and pore formation by lymphocyte perforin On-line, voluntary control of human temporal lobe neurons Overexpression of transcription factor sp2 inhibits epidermal differentiation and increases susceptibility to wound- and carcinogen-induced tumorigenesis Generation of transgene-free lung disease-specific human induced pluripotent stem cells using a single excisable lentiviral stem cell cassette Transmembrane potential of GlyCl-expressing instructor cells induces a neoplastic-like conversion of melanocytes via a serotonergic pathway Elastomeric osteoconductive synthetic scaffolds with acquired osteoinductivity expedite the repair of critical femoral defects in rats Transfection of shRNA-encoding Minivector DNA of a few hundred base pairs to regulate gene expression in lymphoma cells Synthetic lethality screens reveal RPS6 and MST1R as modifiers of insulin-like growth factor-1 receptor inhibitor activity in childhood sarcomas Efficient CNS gene delivery by intravenous injection Loss of inositol polyphosphate 5-phosphatase is an early event in development of cutaneous squamous cell carcinoma p63 and p73 are required for p53-dependent apoptosis in response to DNA damage TAp63 suppresses metastasis through coordinate regulation of Dicer and miRNAs Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation Enhancement of RAD51 recombinase activity by the tumor suppressor PALB2 Reversal of depressed behaviors in mice by p11 gene therapy in the nucleus accumbens Sept4/ARTS is required for stem cell apoptosis and tumor suppression Targeting mitochondrial glutaminase activity inhibits oncogenic transformation Piezo1 and Piezo2 are essential components of distinct mechanically activated cation channels SNPs associated with cerebrospinal fluid phospho-tau levels influence rate of decline in Alzheimer's disease Selective inhibition of BET bromodomains Nucleotide excision repair deficiency is intrinsic in sporadic stage I breast cancer Allelic variation at the 8q23.3 colorectal cancer risk locus functions as a cis-acting regulator of EIF3H Reconstruction of the complete human cytomegalovirus genome in a BAC reveals RL13 to be a potent inhibitor of replication Granulocyte-colony stimulating factor reactivates human cytomegalovirus in a latently infected humanized mouse model Intestinal stem cell replacement follows a pattern of neutral drift Pharmacological inhibition of EGFR signaling enhances G-CSF–induced hematopoietic stem cell mobilization A human MAP kinase interactome AID-induced genotoxic stress promotes B cell differentiation in the germinal center via ATM and LKB1 signaling Nanoscale approaches to define biologic signatures and measure proteomic response to targeted therapies in hematologic and solid tumors Nanotopographical control of stem cell differentiation Cone and rod photoreceptor transplantation in models of the childhood retinopathy Leber congenital amaurosis using flow-sorted Crx-positive donor cells Differentially expressed RNA from public microarray data identifies serum protein biomarkers for cross-organ transplant rejection and other conditions Humanized nonobese diabetic-scid IL2rγnull mice are susceptible to lethal Salmonella Typhi infection Cloud-scale RNA-sequencing differential expression analysis with Myrna ARID1A mutations in endometriosis-associated ovarian carcinomas Modulation of K-Ras-dependent lung tumorigenesis by MicroRNA-21 Common variants near CAV1 and CAV2 are associated with primary open-angle glaucoma Endogenous HMGB1 regulates autophagy Selectivity mechanism of the nuclear pore complex characterized by single cargo tracking Gilgamesh is required for rutabaga-independent olfactory learning in Drosophila Bevacizumab vs ranibizumab for age-related macular degeneration: 1-year outcomes of a prospective, double-masked randomised clinical trial In vitro maturation of oocytes via the pre-fabricated self-assembled artificial human ovary MicroRNAs and pharmacogenomics Structures of the CXCR4 chemokine GPCR with small-molecule and cyclic peptide antagonists Molecular pathway and cell state responsible for dissociation-induced apoptosis in human pluripotent stem cells Induction of vertebrate regeneration by a transient sodium current A tubular cell-enriched subpopulation of primary renal cells improves survival and augments kidney function in a rodent model of chronic kidney disease Common variants near CAV1 and CAV2 are associated with primary open-angle glaucoma A genome-wide association study identifies a susceptibility locus for refractive errors and myopia at 15q14 Common genetic variants near the brittle cornea syndrome locus ZNF469 influence the blinding disease risk factor central corneal thickness Genome-wide association identifies ATOH7 as a major gene determining human optic disc size The in vivo performance of plasmonic nanobubbles as cell theranostic agents in zebrafish hosting prostate cancer xenografts Synthetic lethal screen of an EGFR-centered network to improve targeted therapies Personalized epigenomic signatures that are stable over time and covary with body mass index Apatite microtopographies instruct signaling tapestries for progenitor-driven new attachment of teeth Selective cell death mediated by small conditional RNAs Frequent mutations of chromatin remodeling gene ARID1A in ovarian clear cell carcinoma A microfluidic bioreactor with integrated transepithelial electrical resistance (TEER) measurement electrodes for evaluation of renal epithelial cells The implantable artificial kidney A spindle-independent cleavage furrow positioning pathway Homocysteine-lowering by B vitamins slows the rate of accelerated brain atrophy in mild cognitive impairment: a randomized controlled trial Epigenetic regulation of stem cell maintenance in the drosophila testis via the nucleosome-remodeling factor NURF Chronic monoacylglycerol lipase blockade causes functional antagonism of the endocannabinoid system Insulin resistance is associated with the pathology of Alzheimer disease Puma is required for p53-induced depletion of adult stem cells Nonsense mutations in FAM161A cause RP28-associated recessive retinitis pigmentosa CRX ChIP-seq reveals the cis-regulatory architecture of mouse photoreceptors Protamine contents and P1/P2 ratio in human spermatozoa from smokers and non-smokers Cigarette smoking during early pregnancy reduces the number of embryonic germ and somatic cells Genome-wide association study of migraine implicates a common susceptibility variant on 8q22.1 Non-muscle myosin II regulates survival threshold of pluripotent stem cells γ-Secretase inhibitors enhance temozolomide treatment of human gliomas by inhibiting neurosphere repopulation and xenograft recurrence Combinatorial development of biomaterials for clonal growth of human pluripotent stem cells Whole-exome sequencing identifies recessive WDR62 mutations in severe brain malformations A new research and development policy framework for the biomedical research enterprise Female human iPSCs retain an inactive X chromosome Complement factor H polymorphism and age-related macular degeneration E2-2 protein and Fuchs's corneal dystrophy The lingering consequences of sepsis: a hidden public health disaster? Long-term cognitive impairment and functional disability among survivors of severe sepsis Pericyte-based human tissue engineered vascular grafts Non-canonical inhibition of DNA damage-dependent ubiquitination by OTUB1 The distinct metabolic profile of hematopoietic stem cells reflects their location in a hypoxic niche Inhibition of mutated, activated BRAF in metastatic melanoma The molecular interaction of CAR and JAML recruits the central cell signal transducer PI3K The junctional adhesion molecule JAML is a costimulatory receptor for epithelial γδT cell activation A biosynthetic alternative to human donor tissue for inducing corneal regeneration: 24-month follow-up of a phase 1 clinical study BRCA1 basal-like breast cancers originate from luminal epithelial progenitors and not from basal stem cells Mitotic recombination in patients with ichthyosis causes reversion of dominant mutations in KRT10 Complement-mediated regulation of the IL-17A axis is a central genetic determinant of the severity of experimental allergic asthma Functional diversity of ESC-derived motor neuron subtypes revealed through intraspinal transplantation Crystal structure of human adenovirus at 3.5 Å resolution Identity-by-descent filtering of exome sequence data identifies PIGV mutations in hyperphosphatasia mental retardation syndrome Adeno-associated viral vector-induced overexpression of neuropeptide Y Y2 receptors in the hippocampus suppresses seizures Heterochromatin silencing of p53 target genes by a small viral protein A unifying genetic model for facioscapulohumeral muscular dystrophy Human neural stem cells differentiate and promote locomotor recovery in an early chronic spinal cord injury NOD-scid mouse model A regulatory toolbox of MiniPromoters to drive selective expression in the brain Myc represses primitive endoderm differentiation in pluripotent stem cells Atomic structure of human adenovirus by cryo-EM reveals interactions among protein networks Optimal matrix rigidity for stress-fibre polarization in stem cells GPR120 is an omega-3 fatty acid receptor mediating potent anti-inflammatory and insulin-sensitizing effects Association between reduced copy-number at T-cell receptor gamma (TCRgamma) and childhood allergic asthma: A possible role for somatic mosaicism PDE11A associations with asthma: Results of a genome-wide association scan CD31+ cells represent highly angiogenic and vasculogenic cells in bone marrow Human peripheral blood-derived CD31+ cells have robust angiogenic and vasculogenic properties and are effective for treating ischemic vascular disease Modeling inherited metabolic disorders of the liver using human induced pluripotent stem cells A kinetochore-independent mechanism drives anaphase chromosome separation during acentrosomal meiosis Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2 Ascorbate promotes epigenetic activation of CD30 in human embryonic stem cells Vitamin C promotes widespread yet specific DNA demethylation of the epigenome in human embryonic stem cells Mammalian microRNAs predominantly act to decrease target mRNA levels SIK2 is a centrosome kinase required for bipolar mitotic spindle formation that provides a potential target for therapy in ovarian cancer Mediator and cohesin connect gene expression and chromatin architecture Microenvironmental reprogramming of thymic epithelial cells to skin multipotent stem cells Combinatorial development of biomaterials for clonal growth of human pluripotent stem cells Evolution of an adenocarcinoma in response to selection by targeted kinase inhibitors Proangiogenic scaffolds as functional templates for cardiac tissue engineering Crohn's disease activity index does not correlate with endoscopic recurrence one year after ileocolonic resection Bone marrow transplantation for recessive dystrophic epidermolysis bullosa MicroRNA miR-125a controls hematopoietic stem cell number Exome sequencing identifies MLL2 mutations as a cause of Kabuki syndrome Production of p53 gene knockout rats by homologous recombination in embryonic stem cells Optical pacing of the embryonic heart Nf2/Merlin controls progenitor homeostasis and tumorigenesis in the liver Vitamin D3 attenuates Th2 responses to Aspergillus fumigatus mounted by CD4+ T cells from cystic fibrosis patients with allergic bronchopulmonary aspergillosis Genome-wide association study identifies variants in the CFH region associated with host susceptibility to meningococcal disease An interferon-inducible neutrophil-driven blood transcriptional signature in human tuberculosis Presence of a putative tumor-initiating progenitor cell population predicts poor prognosis in smokers with non–small cell lung cancer Tumor heterogeneity is an active process maintained by a mutant EGFR-induced cytokine circuit in glioblastoma MicroRNA-29a regulates intestinal membrane permeability in patients with irritable bowel syndrome MicroRNA-132–mediated loss of p120RasGAP activates the endothelium to facilitate pathological angiogenesis Susceptibility to chronic pain following nerve injury is genetically affected by CACNG2 New class of gene-termini-associated human RNAs suggests a novel RNA copying mechanism Molecular targeting of intracellular compartments specifically in cancer cells From noncoding variant to phenotype via SORT1 at the 1p13 cholesterol locus Biological, clinical and population relevance of 95 loci for blood lipids Phase I/II study of oncolytic HSVGM-CSF in combination with radiotherapy and cisplatin in untreated stage III/IV squamous cell cancer of the head and neck Bevacizumab vs ranibizumab for age-related macular degeneration: 1-year outcomes of a prospective, double-masked randomised clinical trial POD nanoparticles expressing GDNF provide structural and functional rescue of light-induced retinal degeneration in an adult mouse Pivotal advance: the pattern recognition receptor ligands lipopolysaccharide and polyinosine-polycytidylic acid stimulate factor B synthesis by the macrophage through distinct but overlapping mechanisms Anthropometric measures and their relation to incident primary open-angle glaucoma Deletion of the potassium channel Kv12.2 causes hippocampal hyperexcitability and epilepsy Pathogenic LRRK2 negatively regulates microRNA-mediated translational repression Force-controlled spatial manipulation of viable mammalian cells and micro-organisms by means of FluidFM technology Mesenchymal and haematopoietic stem cells form a unique bone marrow niche Defective erythroid differentiation in miR-451 mutant mice mediated by 14-3-3ζ Transient inactivation of Rb and ARF yields regenerative cells from postmitotic mammalian muscle Direct reprogramming of fibroblasts into functional cardiomyocytes by defined factors PNPASE regulates RNA import into mitochondria High-throughput tracking of pluripotent human embryonic stem cells with dual fluorescence resonance energy transfer molecular beacons An alphavirus vector overcomes the presence of neutralizing antibodies and elevated numbers of Tregs to induce immune responses in humans with advanced cancer Polycomb target genes are silenced in multiple myeloma Scalable synthetic oligodeoxynucleotide purification with use of a catching by polymerization, washing, and releasing approach Induction of human β-cell proliferation and engraftment using a single G1/S regulatory molecule, cdk6 FAN1 acts with FANCI-FANCD2 to promote DNA interstrand cross-link repair Regulation of the autophagy protein LC3 by phosphorylation Optical coherence tomography detection of subclinical traumatic cartilage injury Regenerative therapy and cancer: in vitro and in vivo studies of the interaction between adipose-derived stem cells and breast cancer cells from clinical isolates Direct evidence of lymphatic function improvement after advanced pneumatic compression device treatment of lymphedema Mechanical regulation of cell function with geometrically modulated elastomeric substrates Bone marrow mesenchymal stem cells stimulate cardiac stem cell proliferation and differentiation Identification of a cell of origin for human prostate cancer Regeneration of the articular surface of the rabbit synovial joint by cell homing: a proof of concept study The efficient generation of induced pluripotent stem (iPS) cells from adult mouse adipose tissue-derived and neural stem cells Innate immune suppression enables frequent transfection with RNA encoding reprogramming proteins Ectopic human mesenchymal stem cell-coated scaffolds in NOD/SCID Mice: an in vivo model of the leukemia niche miR-451 protects against erythroid oxidant stress by repressing 14-3-3ζ Comprehensive, quantitative mapping of T cell epitopes in gluten in celiac disease Cushing's syndrome and fetal features resurgence in adrenal cortex–specific Prkar1a knockout mice NT-020, a natural therapeutic approach to optimize spatial memory performance and increase neural progenitor cell proliferation and decrease inflammation in the aged rat Allogeneic T-cell therapy for Epstein-Barr virus-positive posttransplant lymphoproliferative disease: long-term follow-up Discovery of a proneurogenic, neuroprotective chemical A gene on the HER2 amplicon, C35, is an oncogene in breast cancer whose actions are prevented by inhibition of Syk Genetic reactivation of cone photoreceptors restores visual responses in retinitis pigmentosa MicroRNA miR-125a controls hematopoietic stem cell number Transient inactivation of Rb and ARF yields regenerative cells from postmitotic mammalian muscle Chromatin structure and gene expression programs of human embryonic and induced pluripotent stem cells Role of Tet proteins in 5mC to 5hmC conversion, ES-cell self-renewal and inner cell mass specification Molecular steps of G-overhang generation at human telomeres and its function in chromosome end protection Regulation of myeloid leukaemia by the cell-fate determinant Musashi Substrate elasticity regulates skeletal muscle stem cell self-renewal in culture Origins and diversification of a complex signal transduction system in prokaryotes Kinetic phases of distribution and tumor targeting by T cell receptor engineered lymphocytes inducing robust antitumor responses PTEN inhibition to facilitate intrinsic regenerative outgrowth of adult peripheral axons TGF-β2 alters the characteristics of the neuromuscular junction by regulating presynaptic quantal size Rituximab versus cyclophosphamide for ANCA-associated vasculitis Collective chemotaxis requires contact-dependent cell polarity Cross-species genomics matches driver mutations and cell compartments to model ependymoma A new DAF-16 isoform regulates longevity Functional genomics reveals a BMP-driven mesenchymal-to-epithelial transition in the initiation of somatic cell reprogramming Dynamic single-cell imaging of direct reprogramming reveals an early specifying event Regulation of mouse spermatogonial stem cell differentiation by STAT3 signaling Reprogramming of human peripheral blood cells to induced pluripotent stem cells Genetically abnormal circulating cells in lung cancer patients: an antigen-independent fluorescence in situ hybridization–based case-control study A KRAS-variant in ovarian cancer acts as a genetic marker of cancer risk Signaling kinase AMPK activates stress-promoted transcription via histone H2B phosphorylation SIRT1 suppresses β-amyloid production by activating the α-secretase gene ADAM10 Basal dynamics of p53 reveal transcriptionally attenuated pulses in cycling cells Innate immune suppression enables frequent transfection with RNA encoding reprogramming proteins Irradiation of the potential cancer stem cell niches in the adult brain improves progression-free survival of patients with malignant glioma Mapping the first stages of mesoderm commitment during differentiation of human embryonic stem cells Topological optimization for designing patient-specific large craniofacial segmental bone replacements Reprogramming of T cells from human peripheral blood Human melanoma-initiating cells express neural crest nerve growth factor receptor CD271 Increased mutagenesis and unique mutation signature associated with mitotic gene conversion Musashi-2 regulates normal hematopoiesis and promotes aggressive myeloid leukemia Pax6 is a human neuroectoderm cell fate determinant Serotonergic neurons mediate dyskinesia side effects in Parkinson’s patients with neural transplants Primary tumor genotype is an important determinant in identification of lung cancer propagating cells Subtype-specific genomic alterations define new targets for soft-tissue sarcoma therapy Rational design of envelope identifies broadly neutralizing human monoclonal antibodies to HIV-1 Structural basis for broad and potent neutralization of HIV-1 by antibody VRC01 Allogeneic stem cell transplantation provides durable disease control in poor-risk chronic lymphocytic leukemia:long-term clinical and MRD results of the GCLLSG CLL3X trial Cancerous stem cells: deviant stem cells with cancer-causing misbehavior Ronin/Hcf-1 binds to a hyperconserved enhancer element and regulates genes involved in the growth of embryonic stem cells Genetic variation and neuroimaging measures in Alzheimer disease Self-assembly of three-dimensional prestressed tensegrity structures from DNA A novel mechanism of indole-3-carbinol effects on breast carcinogenesis involves induction of Cdc25A degradation An early T cell lineage commitment checkpoint dependent on the transcription factor Bcl11b Lipid-coated nano-calcium-phosphate (LNCP) for gene delivery Vortex-assisted DNA delivery Phosphorylation stabilizes Nanog by promoting its interaction with Pin1 A recessive screen for genes regulating hematopoietic stem cells Increased osteoarthritis in moose from Isle Royale Ecology of arthritis A thin film detection/response system for pathogenic bacteria Structural changes in a marine podovirus associated with release of its genome into Prochlorococcus Reconstituting organ-level lung functions on a chip Melanocytes are deficient in repair of oxidative DNA damage and UV-induced photoproducts The interaction between Myc and Miz1 is required to antagonize TGFβ-dependent autocrine signaling during lymphoma formation and maintenance Intergroup randomized phase III study of androgen deprivation therapy (ADT) plus radiation therapy (RT) in locally advanced prostate cancer (CaP) (NCIC-CTG, SWOG, MRC-UK, INT: T94-0110; NCT00002633). Genetic reactivation of cone photoreceptors restores visual responses in retinitis pigmentosa A distinctive role for focal adhesion proteins in three-dimensional cell motility Mesenchymal stem cells reduce inflammation while enhancing bacterial clearance and improving survival in sepsis Ablation of the kinase NDR1 predisposes mice to the development of T cell lymphoma Interference with Sin3 function induces epigenetic reprogramming and differentiation in breast cancer cells Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis Molecular characterization of mucosal adherent bacteria and associations with colorectal adenomas Antimethicillin-resistant Staphylococcus aureus (MRSA) activity of 'pacific propolis' and isolated prenylflavanones Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists Diabetes depresses synaptic transmission in sympathetic ganglia by inactivating nAChRs through a conserved intracellular cysteine residue A coding-independent function of gene and pseudogene mRNAs regulates tumour biology Single-cell NF-κB dynamics reveal digital activation and analogue information processing Virus-plus-susceptibility gene interaction determines Crohn's disease gene Atg16L1 phenotypes in intestine Harnessing structure-activity relationship to engineer a cisplatin nanoparticle for enhanced antitumor efficacy Serotonin regulates pancreatic beta cell mass during pregnancy Engineered allosteric activation of kinases in living cells Human amnion epithelial cell transplantation abrogates lung fibrosis and augments repair Tissue-engineered lungs for in vivo implantation Human polynucleotide phosphorylase selectively and preferentially degrades microRNA-221 in human melanoma cells Mitigation of hematologic radiation toxicity in mice through pharmacological quiescence induced by CDK4/6 inhibition Umpolung reactivity in amide and peptide synthesis Multiple epigenetic modifiers induce aggressive viral extinction in extraembryonic endoderm stem cells Gene therapy for type 1 diabetes: a combinatorial approach using neurogenin-3-interleukin-10 hepatic gene transfer reverses diabetes in overtly diabetic NOD mice Variants near DMRT1, TERT and ATF7IP are associated with testicular germ cell cancer Tissue-engineered lungs for in vivo implantation Regeneration and orthotopic transplantation of a bioartificial lung Reconstructing the lung Nucleotide-binding oligomerization domain-2 inhibits toll-like receptor-4 signaling in the intestinal epithelium Tracking differentiating neural progenitors in pluripotent cultures using microRNA-regulated lentiviral vectors Functionally defective germline variants of sialic acid acetylesterase in autoimmunity Influenza A virus-generated small RNAs regulate the switch from transcription to replication Functional impact of global rare copy number variation in autism spectrum disorders Hepcidin mediates transcriptional changes that modulate acute cytokine-induced inflammatory responses in mice Modeling T-cell acute lymphoblastic leukemia induced by the SCL and LMO1 oncogenes The MCL-1 BH3 helix is an exclusive MCL-1 inhibitor and apoptosis sensitizer Lysosomal proteolysis and autophagy require presenilin 1 and are disrupted by Alzheimer-related PS1 mutations Reprogramming of T cells to natural killer–like cells upon Bcl11b deletion Dental pulp cells for induced pluripotent stem cell banking RNA-based gene therapy for HIV with lentiviral vector–modified CD34+ cells in patients undergoing transplantation for AIDS-related lymphoma The matricellular protein CCN1 induces fibroblast senescence and restricts fibrosis in cutaneous wound healing Short RNAs are transcribed from repressed polycomb target genes and interact with polycomb repressive complex-2 Transposable elements have rewired the core regulatory network of human embryonic stem cells Tumour angiogenesis is reduced in the Tc1 mouse model of Down’s syndrome Designing communicating colonies of biomimetic microcapsules Patient-specific induced pluripotent stem-cell-derived models of LEOPARD syndrome In vivo targeting of B-cell lymphoma with glycan ligands of CD22 Phase II trial of daily, oral green tea extract in patients with asymptomatic, Rai stage 0-II chronic lymphocytic leukemia (CLL) Mutations in TMEM216 perturb ciliogenesis and cause Joubert, Meckel and related syndromes Quiescent haematopoietic stem cells are activated by IFN-γ in response to chronic infection A murine ESC-like state facilitates transgenesis and homologous recombination in human pluripotent stem cells A phase III random assignment trial comparing percutaneous hepatic perfusion with melphalan (PHP-mel) to standard of care for patients with hepatic metastases from metastatic ocular or cutaneous melanoma Permanently blocked stem cells derived from breast cancer cell lines Structural basis for 5′-nucleotide base-specific recognition of guide RNA by human AGO2 Gene delivery to mitotic and postmitotic photoreceptors via compacted DNA nanoparticles results in improved phenotype in a mouse model of retinitis pigmentosa A role for the Werner syndrome protein in epigenetic inactivation of the pluripotency factor Oct4 A novel phosphatase cascade regulates differentiation in Trypanosoma brucei via a glycosomal signaling pathway Systemic delivery of scAAV9 expressing SMN prolongs survival in a model of spinal muscular atrophy Functional impact of global rare copy number variation in autism spectrum disorders Regulation of microRNA expression and abundance during lymphopoiesis Effect of zoledronic acid on disseminated tumour cells in women with locally advanced breast cancer: an open label, randomised, phase 2 trial Effective, broad spectrum control of virulent bacterial infections using cationic DNA liposome complexes combined with bacterial antigens Long-lasting reduction in hippocampal neurogenesis by alcohol consumption in adolescent nonhuman primates Migration of engrafted neural stem cells is mediated by CXCL12 signaling through CXCR4 in a viral model of multiple sclerosis Selective changes in thin spine density and morphology in monkey prefrontal cortex correlate with aging-related cognitive impairment A genome-wide RNA interference screen reveals an essential CREB3L2-ATF5-MCL1 survival pathway in malignant glioma with therapeutic implications Identification of a B cell signature associated with renal transplant tolerance in humans Detection of femtomole quantities of mature cathepsin K with zymography Relationship between nucleosome positioning and DNA methylation Gold nanorod delivery of an ssRNA immune activator inhibits pandemic H1N1 influenza viral replication B-lymphoid cells with attributes of dendritic cells regulate T cells via indoleamine 2,3-dioxygenase Three-dimensional early retinal progenitor 3D tissue constructs derived from human embryonic stem cells Pathologic caveolin-1 regulation of PTEN in idiopathic pulmonary fibrosis GJC2 missense mutations cause human lymphedema Is the incidence of rheumatoid arthritis rising?: results from Olmsted County, Minnesota, 1955-2007 Tissue-engineered lungs for in vivo implantation An integrated network of androgen receptor, polycomb, and TMPRSS2-ERG gene fusions in prostate cancer progression CD95 promotes tumour growth Phase I study of anti-CD25 mab daclizumab to deplete regulatory T cells prior to telomerase/survivin peptide vaccination in patients (pts) with metastatic breast cancer (MBC) A phase I study of CD40 agonist monoclonal antibody (CP-870,893) with gemcitabine in pancreatic cancer A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci Gazing into a crystal ball to predict kidney transplant outcome Identification of a B cell signature associated with renal transplant tolerance in humans Development of a cross-platform biomarker signature to detect renal transplant tolerance in humans A molecular classifier for predicting future graft loss in late kidney transplant biopsies Directing astroglia from the cerebral cortex into subtype specific functional neurons Endothelial nitric oxide synthase deficiency causes collateral vessel rarefaction and impairs activation of a cell cycle gene network during arteriogenesis Micro-masonry: construction of 3D structures by microscale self-assembly Nanofiber assembly by rotary jet-spinning Segment-specific neuronal subtype specification by the integration of anteroposterior and temporal cues Common variation in ISL1 confers genetic susceptibility for human congenital heart disease PediaFlow maglev ventricular assist device: a prescriptive design approach Infection rate and acute organ dysfunction risk as explanations for racial differences in severe sepsis Gait biomechanics, spatial and temporal characteristics, and the energy cost of walking in older adults with impaired mobility A prospective U.S. ovarian cancer screening study using the risk of ovarian cancer algorithm (ROCA) A randomized phase II trial comparing exemestane, letrozole, and anastrozole in postmenopausal women with clinical stage II/III estrogen receptor-positive breast cancer Mechanosensitive hair cell-like cells from embryonic and induced pluripotent stem cells Loss of type III transforming growth factor-β receptor expression is due to methylation silencing of the transcription factor GATA3 in renal cell carcinoma Functional heterogeneity of embryonic stem cells revealed through translational amplification of an early endodermal transcript Prothymosin-α inhibits HIV-1 via Toll-like receptor 4-mediated type I interferon induction Complete chemical synthesis, assembly, and cloning of a Mycoplasma genitalium genome Human embryonic stem cells with biological and epigenetic characteristics similar to those of mouse ESCs Derivation of pre-x inactivation human embryonic stem cells under physiological oxygen concentrations Creation of a bacterial cell controlled by a chemically synthesized genome Autophagy as a therapeutic target in cancer treatment Indoor tanning and risk of melanoma: a case-control study in a highly exposed population Human cardiac tissue induces transdifferentiation of adult stem cells towards cardiomyocytes An autophagy-enhancing drug promotes degradation of mutant α1-antitrypsin z and reduces hepatic fibrosis Porcine induced pluripotent stem cells produce chimeric offspring Differential modeling of Fragile X Syndrome by human embryonic stem cells and induced pluripotent stem cells Human embryonic stem cells with biological and epigenetic characteristics similar to those of mouse ESCs A microarray analysis of sexual dimorphism of adipose tissues in high-fat-diet-induced obese mice Retinal glial cells enhance human vision acuity A family history of type 2 diabetes increases risk factors associated with overfeeding A pathobiont of the microbiota balances host colonization and intestinal inflammation Bim-Bcl-2 homology 3 mimetic therapy is effective at suppressing inflammatory arthritis through the activation of myeloid cell apoptosis Permanently blocked stem cells derived from breast cancer cell lines rAAV2/5 gene-targeting to rods:dose-dependent efficiency and complications associated with different promoters Human CD34+ cells in experimental myocardial infarction. long-term survival, sustained functional improvement, and mechanism of action Segment-specific neuronal subtype specification by the integration of anteroposterior and temporal cues A temporarily distinct subpopulation of slow-cycling melanoma cells is required for continuous tumor growth Stem cell transplantation in multiple sclerosis: current status and future prospects Designed biomaterials to mimic the mechanical properties of muscles Endometrial stem cell transplantation restores dopamine production in a parkinson's disease model Circadian-independent cell mitosis in immortalized fibroblasts Generation of pluripotent stem cells from eggs of aging mice CNS transplantation of purified human neural stem cells in neuronal ceroid lipofuscinoses: phase I trial IGF-1R regulation of colon cancer stem cells Resolution of cell fate decisions revealed by single-cell gene expression analysis from zygote to blastocyst Effects of aerobic exercise training on cognitive function and cortical vascularity in monkeys Derepression of an endogenous long terminal repeat activates the CSF1R proto-oncogene in human lymphoma Alternate protein kinase A activity identifies a unique population of stromal cells in adult bone Retargeted adenoviral cancer gene therapy for tumour cells overexpressing epidermal growth factor receptor or urokinase-type plasminogen activator receptor Cyclooxygenase-2 generates anti-inflammatory mediators from omega-3 fatty acids c-Myc regulates transcriptional pause release Maternal circulating CD34+VEGFR-2+ and CD133+VEGFR-2+ progenitor cells increase during normal pregnancy but are reduced in women with preeclampsia Identification of select glucocorticoids as Smoothened agonists: Potential utility for regenerative medicine Mesenchymal stem cells protect breast cancer cells through regulatory T cells: role of mesenchymal stem cell-derived TGF-β XCMS: processing mass spectrometry data for metabolite profiling using nonlinear peak alignment, matching, and identification Metabolic oxidation regulates embryonic stem cell differentiation Sequence variants at CHRNB3–CHRNA6 and CYP2A6 affect smoking behavior Genome-wide meta-analyses identify multiple loci associated with smoking behavior Meta-analysis and imputation refines the association of 15q25 with smoking quantity Synovial fluid proteins differentiate between the subtypes of juvenile idiopathic arthritis Effects of thymic selection of the T-cell repertoire on HLA class I-associated control of HIV infection Progesterone induces adult mammary stem cell expansion Safety and feasibility of autologous bone marrow cellular therapy in relapsing-progressive Multiple Sclerosis Physiological levels of reactive oxygen species are required to maintain genomic stability in stem cells The effect of prenatal smoking exposure on adolescents' use of psychiatric drugs New loci associated with kidney function and chronic kidney disease Targeted gene deletions in C. elegans using transposon excision Activation of the imprinted Dlk1-Dio3 region correlates with pluripotency levels of mouse stem cells HAMLET interacts with lipid membranes and perturbs their structure and integrity Pronuclear transfer in human embryos to prevent transmission of mitochondrial DNA disease Genomic profiling of sentinel lymph node breast cancer metastasis Increased monocyte turnover from bone marrow correlates with severity of SIV encephalitis and CD163 levels in plasma Aberrant silencing of imprinted genes on chromosome 12qF1 in mouse induced pluripotent stem cells Compact, light-weight and cost-effective microscope based on lensless incoherent holography for telemedicine applications Induction of cancer cell death by self-assembling nanostructures incorporating a cytotoxic peptide Itraconazole, a commonly used antifungal that inhibits Hedgehog pathway activity and cancer growth A small-molecule inhibitor of BCL6 kills DLBCL cells in vitro and in vivo Revealing a core signaling regulatory mechanism for pluripotent stem cell survival and self-renewal by small molecules Genetic variants near TIMP3 and high-density lipoprotein–associated loci influence susceptibility to age-related macular degeneration Chronic cisplatin treatment promotes enhanced damage repair and tumor progression in a mouse model of lung cancer Tumor necrosis factor-like weak inducer of apoptosis is a mitogen for liver progenitor cells Isothiocyanate exposure, glutathione S-transferase polymorphisms, and colorectal cancer risk Substitutions in woolly mammoth hemoglobin confer biochemical properties adaptive for cold tolerance p53-mediated hematopoietic stem and progenitor cell competition T helper type 1 and 17 cells determine efficacy of interferon-β in multiple sclerosis and experimental encephalomyelitis Sex differences of chondrogenic progenitor cells in late stages of osteoarthritis In vivo evaluation of a tissue-engineered stem cell vascular graft Conversion of adult pancreatic α-cells to β-cells after extreme β-cell loss Magnetic targeting enhances engraftment and functional benefit of iron-labeled cardiosphere-derived cells in myocardial infarction Derivation, propagation and controlled differentiation of human embryonic stem cells in suspension Epigenetic stability increases extensively during Drosophila follicle stem cell differentiation Control of mammary stem cell function by steroid hormone signaling Nerve growth factor promotes cardiac repair following myocardial infarction Gene delivery to mitotic and postmitotic photoreceptors via compacted DNA nanoparticles results in improved phenotype in a mouse model of retinitis pigmentosa Plant thymidine kinase 1: a novel efficient suicide gene for malignant glioma therapy Labeling human embryonic stem cell-derived cardiomyocytes with indocyanine green for noninvasive tracking with optical imaging: an FDA-compatible alternative to firefly luciferase A chromatin-mediated reversible drug-tolerant state in cancer cell subpopulations Gold nanocages as photothermal transducers for cancer treatment Carbon nanotubes degraded by neutrophil myeloperoxidase induce less pulmonary inflammation Coronary arteries form by developmental reprogramming of venous cells MiDReG: A method of mining developmentally regulated genes using Boolean implications Primary contribution to zebrafish heart regeneration by gata4+ cardiomyocytes Retinoic acid regulates differentiation of the secondary heart field and TGFβ-mediated outflow tract septation Geometric cues for directing the differentiation of mesenchymal stem cells Bone progenitor dysfunction induces myelodysplasia and secondary leukaemia Pleiotrophin regulates the expansion and regeneration of hematopoietic stem cells Corticosteroid suppression of VEGF-A in infantile hemangioma-derived stem cells Comparative genetic analysis of inflammatory bowel disease and type 1 diabetes implicates multiple loci with opposite effects Using nanoparticle-filled microcapsules for site-specific healing of damaged substrates--creating a "repair-and-go" system Inactivation of both foxo and reaper promotes long-term adult neurogenesis in Drosophila Hypoxia inducible microRNA 210 attenuates keratinocyte proliferation and impairs closure in a murine model of ischemic wounds Genetic analysis of variation in transcription factor binding in yeast Variation in transcription factor binding among humans RBPjκ-dependent Notch signaling regulates mesenchymal progenitor cell proliferation and differentiation during skeletal development Safety and efficacy of subretinal readministration of a viral vector in large animals to treat congenital blindness The basal ganglia communicate with the cerebellum A human gut microbial gene catalogue established by metagenomic sequencing Protein folding stability and dynamics imaged in a living cell Scaling laws of marine predator search behavior Human mammary epithelial cells exhibit a bimodal correlated random walk pattern Programmed death-1–induced interleukin-10 production by monocytes impairs CD4+ T cell activation during HIV infection MLL-AF9-induced leukemogenesis requires coexpression of the wild-type Mll allele Lack of p21 expression links cell cycle control and appendage regeneration in mice Evidence of RNAi in humans from systemically administered siRNA via targeted nanoparticles Computational prediction of neural progenitor cell fates Transplantation of reprogrammed embryonic stem cells improves visual function in a mouse model for retinitis pigmentosa Tumor cell-specific bioluminescence platform to identify stroma-induced changes to anticancer drug activity Generation of functional multipotent adult stem cells from GPR125+ germline progenitors Expansion and maintenance of human embryonic stem cell-derived endothelial cells by TGFbeta inhibition is Id1 dependent Instructive role of the vascular niche in promoting tumour growth and tissue repair by angiocrine factors Generation of a functional and durable vascular niche by the adenoviral E4ORF1 gene Endothelial cells are essential for the self-renewal and repopulation of notch-dependent hematopoietic stem cells Kinetics of antimicrobial peptide activity measured on individual bacterial cells using high-speed atomic force microscopy Leptin therapy in insulin-deficient type I diabetes miR-125b-2 is a potential oncomiR on human chromosome 21 in megakaryoblastic leukemia Hydrated xenogeneic decellularized tracheal matrix as a scaffold for tracheal reconstruction Innate immune lectins kill bacteria expressing blood group antigen Common genetic variants associated with breast cancer and mammographic density measures that predict disease Regulation of Rap2A by the ubiquitin ligase Nedd4-1 controls neurite development Haematopoietic stem cells derive directly from aortic endothelium during development Neural differentiation of human induced pluripotent stem cells follows developmental principles but with variable potency Daclizumab in active relapsing multiple sclerosis (CHOICE study): a phase 2, randomised, double-blind, placebo-controlled, add-on trial with interferon beta Caspase 3/caspase-activated DNase promote cell differentiation by inducing DNA strand breaks Risk of recurrent stroke, myocardial infarction, or death in hospitalized stroke patients Nutrient-sensitized screening for drugs that shift energy metabolism from mitochondrial respiration to glycolysis Computational prediction of neural progenitor cell fates TGF-β-mediated phosphorylation of hnRNP E1 induces EMT via transcript-selective translational induction of Dab2 and ILEI Gallstones play a significant role in Salmonella spp. gallbladder colonization and carriage Nuclear targeting of gold nanoparticles in cancer cells induces DNA damage, causing cytokinesis arrest and apoptosis Effects of carboxylic acids on nC60 aggregate formation Characterization of airborne particles during production of carbonaceous nanomaterials U87MG decoded: the genomic sequence of a cytogenetically aberrant human cancer cell line Role of DAB2IP in modulating epithelial-to-mesenchymal transition and prostate cancer metastasis Quorum-sensing-regulated virulence factors in Pseudomonas aeruginosa are toxic to Lucilia sericata maggots Molecular basis of the death-associated protein kinase–calcium/calmodulin regulator complex Communication via gap junctions underlies early functional and beneficial interactions between grafted neural stem cells and the host Cancer stem cells from colorectal cancer-derived cell lines Coexistence of quiescent and active adult stem cells in mammals A nonviral minicircle vector for deriving human iPS cells Acute kidney injury in non-severe pneumonia is associated with an increased immune response and lower survival Cell fusion of bone marrow cells and somatic cell reprogramming by embryonic stem cells Amplification of LAPTM4B and YWHAZ contributes to chemotherapy resistance and recurrence of breast cancer Chronic morphine administration delays wound healing by inhibiting immune cell recruitment to the wound site Tinkering inside the organelle Dynamic changes in the human methylome during differentiation DNA heats up: energetics of genome ejection from phage revealed by isothermal titration calorimetry Pharmacologic inhibition of fatty acid oxidation sensitizes human leukemia cells to apoptosis induction Aberrant alternative splicing and extracellular matrix gene expression in mouse models of myotonic dystrophy Direct conversion of fibroblasts to functional neurons by defined factors Pluripotency factors Lin28 and Oct4 identify a sub-population of stem cell-like cells in ovarian cancer CRFR1 is expressed on pancreatic β cells, promotes β cell proliferation, and potentiates insulin secretion in a glucose-dependent manner Anucleate platelets generate progeny The alternative splicing repressors hnRNP A1/A2 and PTB influence pyruvate kinase isoform expression and cell metabolism Brainstem serotonergic deficiency in sudden infant death syndrome Regulation of alternative splicing by histone modifications G protein subunit Gα13 binds to integrin αIIbβ3 and mediates integrin "outside-in" signaling Cyclin D1 kinase activity is required for the self-renewal of mammary stem and progenitor cells that are targets of MMTV-ErbB2 tumorigenesis Modulation of heat shock transcription factor 1 as a therapeutic target for small molecule intervention in neurodegenerative disease Interaction between RasV12 and scribbled clones induces tumor growth and invasion Dual roles for perivascular macrophages in immune-to-brain signaling Altered gene expression and DNA damage in peripheral blood cells from Friedreich's Ataxia patients: cellular model of pathology Identification of a class of HCV inhibitors directed against the nonstructural protein NS4B AHI1 is required for photoreceptor outer segment development and is a modifier for retinal degeneration in nephronophthisis The histone deacetylase Sirt6 regulates glucose homeostasis via Hif1α Transforming growth factor β-activated kinase 1 (TAK1) kinase adaptor, TAK1-binding protein 2, plays dual roles in TAK1 signaling by recruiting both an activator and an inhibitor of TAK1 kinase in tumor Genetic variation in GIPR influences the glucose and insulin responses to an oral glucose challenge New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk Glioblastoma cancer-initiating cells inhibit T-cell proliferation and effector responses by the signal transducers and activators of transcription 3 pathway Glioma-associated cancer-initiating cells induce immunosuppression Thymic development beyond β-selection requires phosphatidylinositol 3-kinase activation by CXCR4 Notch-mediated expansion of human cord blood progenitor cells capable of rapid myeloid reconstitution Human stem cell delivery for treatment of large segmental bone defects COUP-TFII regulates tumor growth and metastasis by modulating tumor angiogenesis Amelioration of emphysema in mice through lentiviral transduction of long-lived pulmonary alveolar macrophages Extending the transposable payload limit of Sleeping Beauty (SB) using the Herpes Simplex Virus (HSV)/SB amplicon-vector platform Calculating the potential for within-flight transmission of influenza A (H1N1) APOBEC3 proteins mediate the clearance of foreign DNA from human cells Analysis of dystrophin deletion mutations predicts age of cardiomyopathy onset in Becker Muscular Dystrophy Modeling disease in human ESCs using an efficient BAC-based homologous recombination system Multicenter, phase II study of decitabine for the first-line treatment of older patients with acute myeloid leukemia A biohybrid artificial lung prototype with active mixing of endothelialized microporous hollow fibers Monoacylglycerol lipase regulates a fatty acid network that promotes cancer pathogenesis A new target for amyloid beta toxicity validated by standard and high-throughput electrophysiology A phase II trial of talampanel in subjects with amyotrophic lateral sclerosis A reconfigured pattern of MLL occupancy within mitotic chromatin promotes rapid transcriptional reactivation following mitotic exit Beyond the scalpel: targeting hedgehog in skin cancer prevention Hippocampal mean diffusivity and memory in healthy elderly individuals Production of cell-cell signalling molecules by bacteria isolated from human chronic wounds Restricted ethnic diversity in human embryonic stem cell lines Activation of the abundant nuclear factor poly(ADP-ribose) polymerase-1 by Helicobacter pylori Alzheimer’s-related endosome dysfunction in Down syndrome is Aβ-independent but requires APP and is reversed by BACE-1 inhibition Isolation of cancer-specific chimeric transcripts induced by hypomethylation of the LINE-1 antisense promoter High-performance genetically targetable optical neural silencing by light-driven proton pumps Monocyte/macrophage androgen receptor suppresses cutaneous wound healing in mice by enhancing local TNF-α expression A pharmacogenetic study of docetaxel and thalidomide in patients with castration-resistant prostate cancer using the DMET genotyping platform Smoking, smoking cessation, and risk for type 2 diabetes mellitus: a cohort study CXCR1 blockade selectively targets human breast cancer stem cells in vitro and in xenografts A role for the elongator complex in zygotic paternal genome demethylation Is survival better at hospitals with higher "end-of-life" treatment intensity? Nitric oxide releasing nanoparticles are therapeutic for Staphylococcus aureus abscesses in a murine model of infection The transcriptional network for mesenchymal transformation of brain tumours Dramatic increase in cortical thickness induced by femoral marrow ablation followed by a three-month treatment with PTH in rats Sex-dependent association of common variants of microcephaly genes with brain structure In vivo fluorescent detection of Fe-S clusters coordinated by human GRX2 Electrostatic focusing of unlabelled DNA into nanoscale pores using a salt gradient Real-time imaging reveals the single steps of brain metastasis formation Forever young: how to control the elongation, differentiation, and proliferation of cells using nanotechnology Blanes cells mediate persistent feedforward inhibition onto granule cells in the olfactory bulb Semilunar granule cells: glutamatergic neurons in the rat dentate gyrus with axon collaterals in the inner molecular layer Nonrandom local circuits in the dentate gyrus Representing information in cell assemblies: persistent activity mediated by semilunar granule cells Sec24b selectively sorts Vangl2 to regulate planar cell polarity during neural tube closure Jarid2/Jumonji coordinates control of PRC2 enzymatic activity and target gene occupancy in pluripotent cells Amelioration of emphysema in mice through lentiviral transduction of long-lived pulmonary alveolar macrophages Receptor channel TRPC6 is a key mediator of notch-driven glioblastoma growth and invasiveness The histone variant macroH2A1 marks repressed autosomal chromatin, but protects a subset of its target genes from silencing Tumor self-seeding by circulating cancer cells Lipid-like materials for low-dose, in vivo gene silencing Bioartificial matrices for therapeutic vascularization Impaired hepatocyte regeneration in acute severe hepatic injury enhances effective repopulation by transplanted hepatocytes Long-term effects of bupivacaine on cartilage in a rabbit shoulder model The in vitro effects of bupivacaine on articular chondrocytes Patient-specific, time-varying predictors of post-ICU informal caregiver burden: the caregiver outcomes after ICU discharge project Adipose tissue regeneration Deciding fate in adverse times: sporulation and competence in Bacillus subtilis A selective eradication of human nonhereditary breast cancer cells by phenanthridine-derived polyADP-ribose polymerase inhibitors Identification of mutations in TRAPPC9, which encodes the NIK- and IKK-beta-binding protein, in nonsyndromic autosomal-recessive mental retardation A physical and regulatory map of host-influenza interactions reveals pathways in H1N1 infection The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus Genomewide association study of leprosy An adequately robust early TNF-α response is a hallmark of survival following trauma/hemorrhage A randomized, double-blind, placebo-controlled, dose-escalation study of intravenous adult human mesenchymal stem cells (Prochymal) after acute myocardial infarction JAK-STAT signal inhibition regulates competition in the Drosophila testis stem cell niche Cell therapy of corneal diseases with umbilical mesenchymal stem cells Reduced histone deacetylase 7 activity restores function to misfolded CFTR in cystic fibrosis Transcriptional competence and the active marking of tissue-specific enhancers by defined transcription factors in embryonic and induced pluripotent stem cells A novel inhibitor of DNA polymerase β enhances the ability of temozolomide to impair the growth of colon cancer cells A synergistic small-molecule combination directly eradicates diverse prion strain structures Donor statin treatment protects against severe acute graft-versus-host disease after related allogeneic hematopoietic cell transplantation Adenoviral transfer of HIF-1α enhances vascular responses to critical limb ischemia in diabetic mice Nanoscale cues regulate the structure and function of macroscopic cardiac tissue constructs Targeting breast stem cells with the cancer preventive compounds curcumin and piperine GABAergic interneuron dysfunction impairs hippocampal neurogenesis in adult apolipoprotein E4 knockin mice Imbalance between GABAergic and glutamatergic transmission impairs adult neurogenesis in an animal model of Alzheimer's Disease Engineered “smart” materials for improved cardiomyocyte differentiation Atypical Progeroid Syndrome due to heterozygous missense LMNA mutations Genetic variation in CYP27B1 is associated with congestive heart failure in patients with hypertension RanBPM has proapoptotic activities that regulate cell death pathways in response to DNA damage Induction of death receptor ligand-mediated apoptosis in epithelial ovarian carcinoma: The search for sensitizing agents Isolation of antagonists of antigen-specific autoimmune T cell proliferation Notch promotes radioresistance of glioma stem cells PCNA is required for initiation of recombination-associated DNA synthesis by DNA polymerase δ Surgical stress-induced immune cell redistribution profiles predict short-term and long-term postsurgical recovery Haploid genetic screens in human cells identify host factors used by pathogens Ligand-mediated dimerization of the Met receptor tyrosine kinase by the bacterial invasion protein InlB A selective glial barrier at motor axon exit points prevents oligodendrocyte migration from the spinal cord Protective effects of human iPS-derived retinal pigment epithelium cell transplantation in the retinal dystrophic rat Derivation of functional retinal pigmented epithelium from induced pluripotent stem cells Asymmetric deactivation of HIV-1 gp41 following fusion inhibitor binding In situ regulation of dc subsets and T cells mediates tumor regression in mice A randomized, double-blind, placebo-controlled, dose-escalation study of intravenous adult human mesenchymal stem cells (prochymal) after acute myocardial infarction MEMS-based 3D optical microendoscopy Innate immune and chemically triggered oxidative stress modifies translational fidelity Embryoid body formation of human amniotic fluid stem cells depends on mTOR Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis Defining the role of syndecan-4 in mechanotransduction using surface-modification approaches Progressive chondrocyte death after impact injury indicates a need for chondroprotective therapy High harvest yield, high expansion, and phenotype stability of CD146 mesenchymal stromal cells from whole primitive human umbilical cord tissue Wheelchair repairs, breakdown, and adverse consequences for people with traumatic spinal cord injury A mixed integer linear optimization framework for the identification and quantification of targeted post-translational modifications of highly modified proteins using multiplexed electron transfer dissociation tandem mass spectrometry High throughput characterization of combinatorial histone codes Role of NMDA receptor–dependent activation of SREBP1 in excitotoxic and ischemic neuronal injuries Superselective intraarterial cerebral infusion of bevacizumab: a revival of interventional neuro-oncology for malignant glioma In vivo magnetic enrichment and multiplex photoacoustic detection of circulating tumour cells In vivo, noninvasive, label-free detection and eradication of circulating metastatic melanoma cells using two-color photoacoustic flow cytometry with a diode laser Th22 cells represent a distinct human T cell subset involved in epidermal immunity and remodeling Human embryonic stem-cell derivatives for full reconstruction of the pluristratified epidermis: a preclinical study Three-dimensional nanostructured substrates toward efficient capture of circulating tumor cells FoxJ1-dependent gene expression is required for differentiation of radial glia into ependymal cells and a subset of astrocytes in the postnatal brain A diet enriched in polyphenols and polyunsaturated fatty acids, LMN diet, induces neurogenesis in the subventricular zone and hippocampus of adult mouse brain Donor-recipient mismatch for common gene deletion polymorphisms in graft-versus-host disease MOR23 promotes muscle regeneration and regulates cell adhesion and migration Autologous CD34+ cell therapy for refractory angina: 12 month results of the phase II ACT34-CMI study Live cell imaging distinguishes bona fide human iPS cells from partially reprogrammed cells Adaptive force transmission in amoeboid cell migration Eosinophil-selective binding and proapoptotic effect in vitro of a synthetic Siglec-8 ligand, polymeric 6′-sulfated sialyl Lewis X Tyrosine phosphorylation inhibits PKM2 to promote the Warburg effect and tumor growth Human umbilical cord blood-derived mesenchymal stem cells attenuate hyperoxia-induced lung injury in neonatal rats Autologous umbilical cord blood mononuclear cell transplantation preserves right ventricular function in a novel model of chronic right ventricular volume overload Self-assembling chimeric polypeptide–doxorubicin conjugate nanoparticles that abolish tumours after a single injection Epidemiological pathology of dementia: attributable-risks at death in the medical research council cognitive function and ageing study The heritability and genetics of frontotemporal lobar degeneration A selective eradication of human nonhereditary breast cancer cells by phenanthridine-derived polyADP-ribose polymerase inhibitors Common variants at five new loci associated with early-onset inflammatory bowel disease Rescue of radiation-induced cognitive impairment through cranial transplantation of human embryonic stem cells FoxO3 regulates neural stem cell homeostasis Targeting fibroblast activation protein inhibits tumor stromagenesis and growth in mice Dissociation of EphB2 signaling pathways mediating progenitor cell proliferation and tumor suppression Injectable, rapid gelling and highly flexible hydrogel composites as growth factor and cell carriers Long-term controlled normoglycemia in diabetic non-human primates after transplantation with hCD46 transgenic porcine islets Novel synthetic porous and biodegradable bone cement for orthopaedic and craniofacial regeneration Cell stimulation with optically manipulated microsources Effective repair of traumatically injured spinal cord by nanoscale block copolymer micelles Reprogramming erythroid cells for lysosomal enzyme production leads to visceral and CNS cross-correction in mice with Hurler syndrome TAp63 induces senescence and suppresses tumorigenesis in vivo Translating metabolic exchange with imaging mass spectrometry SPINK1 N34S is strongly associated with recurrent acute pancreatitis but is not a risk factor for the first or sentinel acute pancreatitis event Chemical control over immune recognition: a class of antibody-recruiting small molecules that target prostate cancer An antibody-recruiting small molecule that targets HIV gp120 Human embryonic stem cell-derived oligodendrocyte progenitor cell transplants improve recovery after cervical spinal cord injury Requirement of alpha(4)beta(1) and alpha(5)beta(1) integrin expression in bone-marrow derived progenitor cells in preventing endotoxin-induced lung vascular injury and edema in mice Alcohol stimulates activation of Snail, epidermal growth factor receptor signaling, and biomarkers of epithelial–mesenchymal transition in colon and breast cancer cells The postsynaptic function of type II cochlear afferents Massive gliosis induced by interleukin-6 suppresses Ab deposition in vivo: evidence against inflammation as a driving force for amyloid deposition Lung cancer diagnostic and treatment intervals in the United States: a health care disparity? Mst3b, an Ste20-like kinase, regulates axon regeneration in mature CNS and PNS pathways T helper 17 cells promote cytotoxic T cell activation in tumor immunity Pten in stromal fibroblasts suppresses mammary epithelial tumors Functional repair of human donor lungs by IL-10 gene therapy Activating mutations in FGFR3 and HRAS reveal a shared genetic origin for congenital disorders and testicular tumors DISC1 regulates new neuron development in the adult brain via modulation of AKT-mTOR signaling through KIAA1212 Age-dependent effects of RPE65 gene therapy for Leber's congenital amaurosis: a phase 1 dose-escalation trial Lung myeloid dendritic cells coordinately induce TH1 and TH17 responses in human emphysema Basal cancer cell survival involves JNK2 suppression of a novel JNK1/c-Jun/Bcl-3 apoptotic network Loss of Lkb1 in adult β cells increases β cell mass and enhances glucose tolerance in mice Liver X receptors and oxysterols promote ventral midbrain neurogenesis in vivo and in human embryonic stem cells Directed single molecule diffusion triggered by surface energy gradients A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium Enhanced leukemia cell detection using a novel magnetic needle and nanoparticles Racial differences in the association between SNPs on 15q25.1, smoking behavior, and risk of non-small cell lung cancer Molecular aging and rejuvenation of human muscle stem cells Radioprotection in normal tissue and delayed tumor growth by blockade of CD47 signaling The Argus™ II retinal prosthesis improves the ability of subjects to perform a spatial task Development of a model system for retinogenesis from a highly enriched population of human embryonic stem cell-derived retinal progenitors Retinal transplantation improves vision in macular degeneration and retinitis pigmentosa patients LigluR-mediated visual cortical responses in the rd1 mouse model of retinitis pigmentosa Genetic diagnosis by whole exome capture and massively parallel DNA sequencing Nanoparticle-based bio-barcode assay redefines "undetectable" PSA and biochemical recurrence after radical prostatectomy Generation of induced pluripotent stem cells using recombinant proteins A chemical platform for improved induction of human iPSCs Material properties of the cell dictate stress-induced spreading and differentiation in embryonic stem cells Generation of functional ventricular heart muscle from mouse ventricular progenitor cells Stem cell therapies benefit Alport syndrome Marked induction of the helix-loop-helix protein Id3 promotes the γδ T cell fate and renders their functional maturation notch independent Saturation density of skin fibroblasts as a quantitative screen for human cancer susceptibility Functional interaction of plasmacytoid dendritic cells with multiple myeloma cells: a therapeutic target Activating receptors promote NK cell expansion for maintenance, IL-10 production, and CD8 T cell regulation during viral infection Investigating the role of the extracellular environment in modulating hepatic stellate cell biology with arrayed combinatorial microenvironments GSK-3 is a master regulator of neural progenitor homeostasis Human DNA methylomes at base resolution show widespread epigenomic differences Lhx2 specifies regional fate in Emx1 lineage of telencephalic progenitors generating cerebral cortex Aldehyde dehydrogenase–expressing colon stem cells contribute to tumorigenesis in the transition from colitis to cancer Physiological function and transplantation of scaffold-free and vascularized human cardiac muscle tissue Directed differentiation of human embryonic stem cells into functional retinal pigment epithelium cells Thymic involution in amyotrophic lateral sclerosis Expansion of allospecific regulatory T cells after anergized, mismatched bone marrow transplantation CD4+CD25+Foxp3+ Tregs resolve experimental lung injury in mice and are present in humans with acute lung injury Kcne2 deletion uncovers its crucial role in thyroid hormone biosynthesis Genetic population structure analysis in New Hampshire reveals eastern European ancestry Epistasis and its implications for personal genetics Adenosine and osteopontin contribute to the development of chronic obstructive pulmonary disease Expansion of CD133-expressing liver cancer stem cells in liver-specific phosphatase and tensin homolog deleted on chromosome 10-deleted mice A mathematical model of ischemic cutaneous wounds Differentiation of human embryonic stem cells to a parathyroid-like phenotype Programming the detection limits of biosensors through controlled nanostructuring Lung cancer in never smokers: molecular profiles and therapeutic implications Lung cancer in never smokers: clinical epidemiology and environmental risk factors Lung cancer in never smokers: a call to action LysRS serves as a key signaling molecule in the immune response by regulating gene expression Transcriptional signature and memory retention of human-induced pluripotent stem cells Towards a definition of inorganic nanoparticles from an environmental, health and safety perspective HLA-DR alleles in amyloid β-peptide autoimmunity: a highly immunogenic role for the DRB1*1501 allele Transoral endoscopic inner layer esophagectomy: management of high-grade dysplasia and superficial cancer with organ preservation Dysregulated expression of Fau and MELK is associated with poor prognosis in breast cancer Gene expression profiling reveals new protective roles for vitamin C in human skin cells Regulation of vertebrate nervous system alternative splicing and development by an sr-related protein Genome-wide association reveals three SNPs associated with sporadic amyotrophic lateral sclerosis through a two-locus analysis Mutations in LOXHD1, an evolutionarily conserved stereociliary protein, disrupt hair cell function in mice and cause progressive hearing loss in humans FOXO3a promotes tumor cell invasion through the induction of matrix metalloproteinases Injectable hydrogels for brain tissue regeneration after traumatic brain injury (TBI) C/EBP-alpha and beta couple interfollicular keratinocyte proliferation arrest to commitment and terminal differentiation Telomere extension occurs at most chromosome ends and is uncoupled from fill-in in human cancer cells Five hundred intestinal and multivisceral transplantations at a single center: major advances with new challenges Polymer-functionalized nanodiamond platforms as vehicles for gene delivery 14-3-3z cooperates with ErbB2 to promote ductal carcinoma in situ progression to invasive breast cancer by inducing epithelial-mesenchymal transition A luminal epithelial stem cell that is a cell of origin for prostate cancer Tcf3 and Tcf4 are essential for long-term homeostasis of skin epithelia Epigenetic silencing of death receptor 4 mediates tumor necrosis factor–related apoptosis-inducing ligand resistance in gliomas On the mechanism of multiple lysine methylation by the human mixed lineage leukemia protein-1 (MLL1) core complex The basic leucine zipper transcription factor E4BP4 is essential for natural killer cell development Structural and biological mimicry of protein surface recognition by α/β-peptide foldamers Epigenetic changes during disease progression in a murine model of human chronic lymphocytic leukemia Genetic variation in the prostate stem cell antigen gene PSCA confers susceptibility to urinary bladder cancer Widespread shortening of 3′UTRs by alternative cleavage and polyadenylation activates oncogenes in cancer cells Oxidized lipids enhance RANKL production by T lymphocytes: Implications for lipid-induced bone loss Dual and opposing roles of primary cilia in medulloblastoma development Loss of Parkin or PINK1 function increases Drp1-dependent mitochondrial fragmentation Biologic activity of irradiated, autologous, GM-CSF-secreting leukemia cell vaccines early after allogeneic stem cell transplantation Nanog is the gateway to the pluripotent ground state Modeling early retinal development with human embryonic and induced pluripotent stem cells Tight long-term dynamic doxycycline responsive nigrostriatal GDNF using a single rAAV vector Migration of neurotrophic factors-secreting mesenchymal stem cells toward a quinolinic acid lesion as viewed by magnetic resonance imaging Genetically encoded FRET sensors to monitor intracellular Zn2+ homeostasis Emergent or just complex? Concise review: isolation and characterization of cells from human term placenta: outcome of the first international Workshop on Placenta Derived Stem Cells Production of hepatocyte-like cells from human amnion Naive rat amnion-derived cell transplantation improved left ventricular function and reduced myocardial scar of postinfarcted heart Magnetic tagging increases delivery of circulating progenitors in vascular injury A common MECP2 haplotype associates with reduced cortical surface area in humans in two independent populations DNA focusing using microfabricated electrode arrays Waterborne synthetic adhesives modeled after the Sandcastle glue of P. californica A water-borne adhesive modeled after the sandcastle glue of P. californica Targeted capture and massively parallel sequencing of 12 human exomes A role of histone H3 lysine 4 methyltransferase components in endosomal trafficking Targeted activation of innate immunity for therapeutic induction of autophagy and apoptosis in melanoma cells Sustained transgene expression despite T lymphocyte responses in a clinical trial of rAAV1-AAT gene therapy A role for the transcriptional repressor blimp-1 in CD8+ T cell exhaustion during chronic viral infection Targeted activation of innate immunity for therapeutic induction of autophagy and apoptosis in melanoma cells Human RPE65 gene therapy for leber congenital amaurosis: persistence of early visual improvements and safety at 1 year Regulation of the fibrosis and angiogenesis promoter SPARC/osteonectin in human adipose tissue by weight change, leptin, insulin, and glucose The N-Myc-DLL3 cascade is suppressed by the ubiquitin ligase Huwe1 to inhibit proliferation and promote neurogenesis in the developing brain A granulocyte-macrophage colony–stimulating factor and interleukin-15 fusokine induces a regulatory B cell population with immune suppressive properties Optical torques guide cell motility Cerebellothalamocortical connectivity regulates penetrance in dystonia Generation of mature human myelomonocytic cells through expansion and differentiation of pluripotent stem cell–derived lin–CD34+CD43+CD45+ progenitors A distinct macrophage population mediates metastatic breast cancer cell extravasation, establishment and growth Tumor emergence is sensed by self-specific CD44hi memory Tregs that create a dominant tolerogenic environment for tumors in mice Differentiation of a highly tumorigenic basal cell compartment in urothelial carcinoma STAT3 is required for proliferation and maintenance of multipotency in glioblastoma stem cells Tumor suppression by phospholipase C-β3 via SHP-1-mediated dephosphorylation of Stat5 Cell–cell interaction networks regulate blood stem and progenitor cell fate Phosphoproteomic analysis of human embryonic stem cells Downregulation of miRNA-200c links breast cancer stem cells with normal stem cells Nanoparticle-delivered suicide gene therapy effectively reduces ovarian tumor burden in mice Programming cells by multiplex genome engineering and accelerated evolution Sociodemographic differences in early access to liver transplantation services Phase II trial of dendritic cells loaded with antigens from self-renewing, proliferating autologous tumor cells as patient-specific antitumor vaccines in patients with metastatic melanoma: final report Aberrant luminal progenitors as the candidate target population for basal tumor development in BRCA1 mutation carriers MEK4 function, genistein treatment, and invasion of human prostate cancer cells Intrinsic light response of retinal horizontal cells of teleosts MafB restricts M-CSF-dependent myeloid commitment divisions of hematopoietic stem cells Nanodiamond-insulin complexes as pH-dependent protein delivery vehicles MiR-21 is an EGFR-regulated anti-apoptotic factor in lung cancer in never-smokers Inclusion formation and neuronal cell death through neuron-to-neuron transmission of α-synuclein Critical role for caspase-8 in epidermal growth factor signaling Induction of stem cell gene expression in adult human fibroblasts without transgenes Identification of splenic reservoir monocytes and their deployment to inflammatory sites Mobile genetic element-encoded cytolysin connects virulence to methicillin resistance in MRSA The molecular basis for impaired hypoxia-induced VEGF expression in diabetic tissues EphA2 immunoconjugate as molecularly targeted chemotherapy for ovarian carcinoma Regulation of adult hematopoietic stem cells fate for enhanced tissue-specific repair The intrinsic dynamics of enzymes plays a dominant role in determining the structural changes induced upon inhibitor binding An exploratory pathways analysis of temporal changes induced by spinal cord injury in the rat bladder wall: insights on remodeling and inflammation Amnion: a potent graft source for cell therapy in stroke Direct transdifferentiation of stem/progenitor spermatogonia into reproductive and nonreproductive tissues of all germ layers Neural stem cells improve cognition via BDNF in a transgenic model of Alzheimer disease XIAP discriminates between type I and type II FAS-induced apoptosis Srs2 disassembles Rad51 filaments by a protein-protein interaction triggering ATP turnover and dissociation of Rad51 from DNA Bcl6 mediates the development of T follicular helper cells Enhanced monocyte response and decreased central memory T cells in children with invasive Staphylococcus aureus infections Psychoneuroimmunology--psychology’s gateway to the biomedical future N-myc downstream regulated gene 1 (NDRG1) is fused to ERG in prostate cancer CD47 is an adverse prognostic factor and therapeutic antibody target on human acute myeloid leukemia stem cells CD47 is upregulated on circulating hematopoietic stem cells and leukemia cells to avoid phagocytosis Regulated fluctuations in Nanog expression mediate cell fate decisions in embryonic stem cells Identification of genes conferring resistance to 5-fluorouracil Circulating osteogenic precursor cells in heterotopic bone formation Hearing improvement after Bevacizumab in patients with Neurofibromatosis Type 2 Nanoscale cellular changes in field carcinogenesis detected by partial wave spectroscopy Persistent DNA damage signalling triggers senescence-associated inflammatory cytokine secretion A network model of a cooperative genetic landscape in brain tumors Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome Hematopoietic cytokines can instruct lineage choice Effect of ingested interferon-α on β-cell function in children with new-onset type 1 diabetes Plk1-mediated phosphorylation of topors regulates p53 stability Dependence of mouse embryonic stem cells on threonine catabolism A functional role for adult hippocampal neurogenesis in spatial pattern separation Immune blood biomarkers of Alzheimer disease patients High levels of circulating VEGFR2+ bone marrow–derived progenitor cells correlate with metastatic disease in patients with pediatric solid malignancies Release of HMGB1 in response to proapoptotic glioma killing strategies: efficacy and neurotoxicity Transplantation of cardiac progenitor cells ameliorates cardiac dysfunction after myocardial infarction in mice Chd1 regulates open chromatin and pluripotency of embryonic stem cells HIV reservoir size and persistence are driven by T cell survival and homeostatic proliferation BRIT1/MCPH1 links chromatin remodelling to DNA damage response Gene targeting of a disease-related gene in human induced pluripotent stem and embryonic stem cells The Arp2/3 complex and WASp are required for apical trafficking of Delta into microvilli during cell fate specification of sensory organ precursors Prosaposin inhibits tumor metastasis via paracrine and endocrine stimulation of stromal p53 and Tsp-1 CCR7 signalling as an essential regulator of CNS infiltration in T-cell leukaemia The malignant pleural effusion as a model to investigate intratumoral heterogeneity in lung cancer HUMMR, a hypoxia- and HIF-1a–inducible protein, alters mitochondrial distribution and transport Understanding biophysicochemical interactions at the nano–bio interface Cancer mortality in patients with schizophrenia: an 11-year prospective cohort study Cell derived hierarchical assembly of a novel phosphophoryn-based biomaterial Gene expression profiles of acute exacerbations of idiopathic pulmonary fibrosis. Resistance to age-dependent thymic atrophy in long-lived mice that are deficient in pregnancy-associated plasma protein A. Regulatory T cell differentiation of thymocytes does not require a dedicated antigen-presenting cell but is under T cell-intrinsic developmental control Directing cell motions on micropatterned ratchets The DNA replication FoSTeS/MMBIR mechanism can generate genomic, genic and exonic complex rearrangements in humans A pleiotropically acting microRNA, miR-31, inhibits breast cancer metastasis Formation of conjugated polymer brushes by surface-initiated catalyst-transfer polycondensation Controlling transgene expression in subcutaneous implants using a skin lotion containing the apple metabolite phloretin The vascular basement membrane as “soil” in brain metastasis Halofuginone inhibits TH17 cell differentiation by activating the amino acid starvation response H3K4me3 stimulates the V(D)J RAG complex for both nicking and hairpinning in trans in addition to tethering in cis: implications for translocations Allogeneic stem cell transplantation for acute myeloid leukemia in first complete remission Live-imaging of single stem cells within their niche reveals that a U3snoRNP component segregates asymmetrically and is required for self-renewal in Drosophila Nanocapsule-delivered Sleeping Beauty mediates therapeutic Factor VIII expression in liver sinusoidal endothelial cells of hemophilia A mice Essential role for eIF4GI overexpression in the pathogenesis of inflammatory breast cancer Loss of the Alox5 gene impairs leukemia stem cells and prevents chronic myeloid leukemia A mechanism linking extra centrosomes to chromosomal instability CCR3 is a target for age-related macular degeneration diagnosis and therapy Wnt7a activates the planar cell polarity pathway to drive the symmetric expansion of satellite stem cells Activation of tumor cell integrin αvβ3 controls angiogenesis and metastatic growth in the brain REL, encoding a member of the NF-kB family of transcription factors, is a newly defined risk locus for rheumatoid arthritis Therapeutic microRNA delivery suppresses tumorigenesis in a murine liver cancer model PAMAM nanoparticles promote acute lung injury by inducing autophagic cell death through the Akt-TSC2-mTOR signaling pathway Distinctive chromatin in human sperm packages genes for embryo development Global gene expression analysis of reactive stroma in prostate cancer Targeting tumor endothelial marker 8 in the tumor vasculature of colorectal carcinomas in mice Repeated aerosol delivery of carboxyl-terminal modulator protein suppresses tumor in the lungs of K-rasLA1 mice Zebrafish chemical screening reveals an inhibitor of Dusp6 that expands cardiac cell lineages The role of Scgb1a1+ clara cells in the long-term maintenance and repair of lung airway, but not alveolar, epithelium Life and death by death receptors Tumor vasculature is regulated by PHD2-mediated angiogenesis and bone marrow-derived cell recruitment Functional substitution by TAT-utrophin in dystrophin-deficient mice Prediction of response to alkylator-based chemotherapy in metastatic melanoma (MM) using gene expression and promoter methylation signatures Biomechanical regulation of blood vessel growth during tissue vascularization Disease-corrected haematopoietic progenitors from Fanconi anaemia induced pluripotent stem cells Generation of pig-induced pluripotent stem cells with a drug-inducible system The aIRE1-XBP1 pathway of the unfolded protein response is required for adipogenesis Development of microfluidics as endothelial progenitor cell capture technology for cardiovascular tissue engineering and diagnostic medicine Gene expression profiling of preplate neurons destined for the subplate: genes involved in transcription, axon extension, neurotransmitter regulation, steroid hormone signaling, and neuronal survival Reciprocal responsiveness to interleukin-12 and interferon-a specifies human CD8+ effector versus central memory T-cell fates Delivery of adipose-derived precursor cells for peripheral nerve repair Phase III randomized trial of the chimeric anti-GD2 antibody ch14.18 with GM-CSF and IL2 as immunotherapy following dose intensive chemotherapy for high-risk neuroblastoma: Children’s Oncology Group (COG) study ANBL0032 Efficient siRNA delivery into primary cells by a peptide transduction domain–dsRNA binding domain fusion protein Simulation and prediction of the adaptive immune response to influenza A virus infection Implantable diagnostic device for cancer monitoring Capsid antigen presentation flags human hepatocytes for destruction after transduction by adeno-associated viral vectors Biomechanical forces promote embryonic haematopoiesis Hematopoietic stem cell development is dependent on blood flow Nest making and oxytocin comparably promote wound healing in isolation reared rats A new role for FGF2 as an endogenous inhibitor of anxiety Cyclophilin A enhances vascular oxidative stress and the development of angiotensin II–induced aortic aneurysms Ube3a is required for experience-dependent maturation of the neocortex Non-expanded adipose stromal vascular fraction cell therapy for multiple sclerosis Directed transdifferentiation of mouse mesoderm to heart tissue by defined factors Surface antigen phenotypes of hematopoietic stem cells from embryos and murine embryonic stem cells Methods for human demographic inference using haplotype patterns from genomewide single-nucleotide polymorphism data Cotransplantation of mouse embryonic stem cells and bone marrow stromal cells following spinal cord injury suppresses tumor development Genes that mediate breast cancer metastasis to the brain Engineering three-dimensional cartilage- and bone-like tissues using human dermal fibroblasts and macroporous gelatine microcarriers Base excision by thymine DNA glycosylase mediates DNA-directed cytotoxicity of 5-fluorouracil Stem cell therapy restores transparency to defective murine corneas Self-regulation of inflammatory cell trafficking in mice by the leukocyte surface apyrase CD39 Dendrimers as synthetic gene vectors: Cell membrane attachment Lymphocyte crawling and transendothelial migration require chemokine triggering of high-affinity LFA-1 integrin Serial time-encoded amplified imaging for real-time observation of fast dynamic phenomena All-in-one target-cell-specific magnetic nanoparticles for simultaneous molecular imaging and siRNA delivery CD4+ CD25+ T cells control autoimmunity in the absence of B cells miR-375 maintains normal pancreatic α- and β-cell mass Cell–cell contact globally activates microRNA biogenesis Intravaginal gene silencing using biodegradable polymer nanoparticles densely loaded with small-interfering RNA Transcription factor ELF4 controls the proliferation and homing of CD8+ T cells via the Krüppel-like factors KLF4 and KLF2 Repair of the tympanic membrane with urinary bladder matrix Atomic force microscopy detects differences in the surface brush of normal and cancerous cells Regulator of calcineurin (RCAN1-1L) is deficient in Huntington disease and protective against mutant huntingtin toxicity in vitro LGMD 2D gene therapy restores alpha-sarcoglycan and associated proteins Targeted bisulfite sequencing reveals changes in DNA methylation associated with nuclear reprogramming Aldehyde dehydrogenase 1 is a marker for normal and malignant human colonic stem cells (sc) and tracks sc overpopulation during colon tumorigenesis Human CD133+ progenitor cells promote the healing of diabetic ischemic ulcers by paracrine stimulation of angiogenesis and activation of Wnt signaling Parvalbumin neurons and gamma rhythms enhance cortical circuit performance Phasic firing in dopaminergic neurons is sufficient for behavioral conditioning A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation A computational model of the role of presenilin-1 and glycogen synthase kinase-3 in familial Alzheimer’s disease Single molecule–sensitive probes for imaging RNA in live cells Nanofluidic proteomic assay for serial analysis of oncoprotein activation in clinical specimens Bmi1 lineage tracing identifies a self-renewing pancreatic acinar cell subpopulation capable of maintaining pancreatic organ homeostasis Revascularization of ischemic limbs after transplantation of human bone marrow cells with high aldehyde dehydrogenase activity NCRs and DNAM-1 mediate NK cell recognition and lysis of human and mouse melanoma cell lines in vitro and in vivo JunB protects against myeloid malignancies by limiting hematopoietic stem cell proliferation and differentiation without affecting self-renewal Molecular stages of rapid and uniform neuralization of human embryonic stem cells Thymosin beta4 mediated PKC activation is essential to initiate the embryonic coronary developmental program and epicardial progenitor cell activation in adult mice in vivo Adenovirus encoding human platelet-derived growth factor-b delivered to alveolar bone defects exhibits safety and biodistribution profiles favorable for clinical use Protein-directed synthesis of highly fluorescent gold nanoclusters Oncolytic reovirus effectively targets breast cancer stem cells A functional screen to identify novel effectors of hematopoietic stem cell activity Ezh2 orchestrates gene expression for the stepwise differentiation of tissue-specific stem cells Histone modifications at human enhancers reflect global cell-type-specific gene expression Neurogenin3 is sufficient for transdetermination of hepatic progenitor cells into neo-islets in vivo but not transdifferentiation of hepatocytes Programmed subcellular release for studying the dynamics of cell detachment MERIT40 controls BRCA1–Rap80 complex integrity and recruitment to DNA double-strand breaks Molecular therapy of obesity and diabetes by a physiological autoregulatory approach Frankincense oil derived from Boswellia carteri induces tumor cell specific cytotoxicity The influence of macrophage migration inhibitory factor gene polymorphisms on outcome from community-acquired pneumonia Differences in immune response may explain lower survival among older men with pneumonia Cancer-specific transgene expression mediated by systemic injection of nanoparticles Long-term survival and integration of transplanted engineered nervous tissue constructs promotes peripheral nerve regeneration MicroRNA-125b is a novel negative regulator of p53 The support of neural stem cells transplanted into stroke-induced brain cavities by PLGA particles A functional genomic screen identifies cellular cofactors of hepatitis C virus replication Common variants at ten loci modulate the QT interval duration in the QTSCD Study β1 integrin cytoplasmic domain residues selectively modulate fibronectin matrix assembly and cell spreading through talin and Akt-1 Constitutive ablation of dendritic cells breaks self-tolerance of CD4 T cells and results in spontaneous fatal autoimmunity Dendritic cell targeting of Bacillus anthracis protective antigen expressed by Lactobacillus acidophilus protects mice from lethal challenge Identification of IFRD1 as a modifier gene for cystic fibrosis lung disease CD98hc facilitates B cell proliferation and adaptive humoral immunity Structural insights into the molecular organization of the S-layer from Clostridium difficile Identification of progenitor cells that contribute to heterotopic skeletogenesis Disruption of fast axonal transport is a pathogenic mechanism for intraneuronal amyloid beta Can phase III trial results of antidepressant medications be generalized to clinical practice? A STAR*D report A unified mathematical model for the prediction of controlled release from surface and bulk eroding polymer matrices ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing Gold nanorod/Fe3O4 nanoparticle "nano-pearl-necklaces" for simultaneous targeting, dual-mode imaging, and photothermal ablation of cancer cells Imaging intracellular viscosity of a single cell during photoinduced cell death New insights into the genetics of addiction BrafV600E cooperates with Pten loss to induce metastatic melanoma The neural origins of shell structure and pattern in aquatic mollusks Instant immunity through chemically programmable vaccination and covalent self-assembly Transcription factor Achaete Scute-Like 2 controls intestinal stem cell fate piggyBac transposition reprograms fibroblasts to induced pluripotent stem cells Supervised risk predictor of breast cancer based on intrinsic subtypes Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and B-catenin stabilization Telomerase insufficiency in rheumatoid arthritis An embryonic stem cell chromatin remodeling complex, esBAF, is an essential component of the core pluripotency transcriptional network An embryonic stem cell chromatin remodeling complex, esBAF, is essential for embryonic stem cell self-renewal and pluripotency Programmed assembly of 3-dimensional microtissues with defined cellular connectivity A fluidic device to study directional angiogenesis in complex tissue and organ culture models Toll-like receptor 2-dependent induction of vitamin A-metabolizing enzymes in dendritic cells promotes T regulatory responses and inhibits autoimmunity A rosette-type, self-renewing human ES cell-derived neural stem cell with potential for in vitro instruction and synaptic integration Partial-wave microscopic spectroscopy detects subwavelength refractive index fluctuations: an application to cancer diagnosis The reciprocal coordination and mechanics of molecular motors in living cells Endocrine-immune-paracrine interactions in prostate cells as targeted by phytomedicines From donuts to drugs: nano-biotechnology evolution or revolution? A two-step mechanism for stem cell activation during hair regeneration Cardiac fibroblasts regulate myocardial proliferation through B1 integrin signaling Identification of antigen-presenting dendritic cells in mouse aorta and cardiac valves Directed evolution of adeno-associated virus to an infectious respiratory virus Glycogen synthase kinase 3β missplicing contributes to leukemia stem cell generation A multi-center, randomized, clinical study to compare the effect and safety of autologous cultured osteoblast(Ossron™) injection to treat fractures Lumican inhibits collagen deposition in tissue engineered cartilage Atomic structure reveals the unique capsid organization of a dsRNA virus Superoxide dismutase 3, extracellular (SOD3) variants and lung function Endotoxin uptake in mouse liver is blocked by endotoxin pretreatment through a suppressor of cytokine signaling-1-dependent mechanism Three-dimensional ultrahigh resolution optical coherence tomography imaging of age-related macular degeneration Interferometric fluorescent super-resolution microscopy resolves 3D cellular ultrastructure Difference between the abilities of human Fc Y receptor-expressing CV-1 cells to neutralize American and Asian genotypes of Dengue Virus 2 Oct4-induced pluripotency in adult neural stem cells Hierarchical maintenance of MLL myeloid leukemia stem cells employs a transcriptional program shared with embryonic rather than adult stem cells Aberrant miR-182 expression promotes melanoma metastasis by repressing FOXO3 and microphthalmia-associated transcription factor Hypernitrosylated ryanodine receptor calcium release channels are leaky in dystrophic muscle Screening and characterization of surface-tethered cationic peptides for antimicrobial activity CXCL10 impairs B cell function and viability in diabetes through TLR4 signaling Epigenetic regulation of microRNAs in acute lymphoblastic leukemia Association of reactive oxygen species levels and radioresistance in cancer stem cells Controlling cell position in complex heterotypic 3D microtissues by tissue fusion Partial reversal of Rett Syndrome-like symptoms in MeCP2 mutant mice A genome-wide survey of the prevalence and evolutionary forces acting on human nonsense SNPs Control of large, established tumor xenografts with genetically retargeted human T cells containing CD28 and CD137 domains Nkx2–5 transactivates the Ets-related protein 71 gene and specifies an endothelial/endocardial fate in the developing embryo An acellular matrix-bound ligand enhances the mobilization, recruitment and therapeutic effects of circulating progenitor cells in a hindlimb ischemia model Luminal flow patterns dictate arterial drug deposition in stent-based delivery Autologous non-myeloablative haemopoietic stem cell transplantation in relapsing-remitting multiple sclerosis: a phase I/II study Biohybrid devices and encapsulation technologies for engineering a bioartificial pancreas The choice of anatomical site for islet transplantation Genome-wide interrogation of germline genetic variation associated with treatment response in childhood acute lymphoblastic leukemia Regulation of the IL-23 and IL-12 balance by Stat3 signaling in the tumor microenvironment Infection-mimicking materials to program dendritic cells in situ Chromatin signature reveals over a thousand highly conserved large non-coding RNAs in mammals Metabolic dysregulation and adipose tissue fibrosis: the role of collagen VI Comparison of autologous full-thickness gingiva and skin substitutes for wound healing The role of tumor cell–derived connective tissue growth factor (CTGF/CCN2) in pancreatic tumor growth Alpha-synuclein is part of a diverse and highly conserved interaction network that includes PARK9 and manganese toxicity Model of genetic variation in human social networks Transient elastic support for vein grafts using a constricting microfibrillar polymer wrap Human embryonic stem cell differentiation toward regional specific neural precursors Dysregulation of CalDAG-GEFI and CalDAG-GEFII predicts the severity of motor side-effects induced by anti-parkinsonian therapy Dynamic proteomics of individual cancer cells in response to a drug On the role of cell signaling models in cancer research Survival from hypoxia in C. elegans by inactivation of aminoacyl-tRNA synthetases Anthracycline chemotherapy inhibits HIF-1 transcriptional activity and tumor-induced mobilization of circulating angiogenic cells Neuroblastoma cell lines contain pluripotent tumor initiating cells that are susceptible to a targeted oncolytic virus Axon regeneration requires a conserved MAP kinase pathway miRNA in situ hybridization in formaldehyde and EDC–fixed tissues Different T cell receptor signals determine CD8+ memory versus effector development Intravital imaging of metastatic behavior through a mammary imaging window Nanoscale imaging of molecular positions and anisotropies Photoactivatable mCherry for high-resolution two-color fluorescence microscopy T-cell activation leads to reduced collagen maturation in atherosclerotic plaques of Apoe–/– mice Mre11 nuclease activity has essential roles in DNA repair and genomic stability distinct from ATM activation Dopamine modulates an mGluR5-mediated depolarization underlying prefrontal persistent activity Hyperactivity and hyperconnectivity of the default network in schizophrenia and in first-degree relatives of persons with schizophrenia Programmed assembly of DNA-coated nanowire devices The human colon cancer methylome shows similar hypo- and hypermethylation at conserved tissue-specific CpG island shores HMGB1 mediates endogenous TLR2 activation and brain tumor regression Reduced COX-2 expression in aged mice is associated with impaired fracture healing A subpopulation of mouse esophageal basal cells has properties of stem cells with the capacity for self-renewal and lineage specification Near-infrared gold nanocages as a new class of tracers for photoacoustic sentinel lymph node mapping on a rat model Pick-and-place using chemically actuated microgrippers Tetherless thermobiochemically actuated microgrippers DNA repair gene polymorphisms and risk of pancreatic cancer Positive regulation of plasmacytoid dendritic cell function via Ly49Q recognition of class I MHC Prolonged continuous in vitro human platelet production using three-dimensional scaffolds Nuclear import is required for the pro-apoptotic function of the Golgi protein p115 Induced pluripotent stem cells from a spinal muscular atrophy patient Survey of the human pancreatic beta cell G1/S proteome reveals a potential therapeutic role for Cdk-6 and cyclin D1 in enhancing human beta cell replication and function in vivo Tissue-engineered skin containing mesenchymal stem cells improves burn wounds Deletion of IKZF1 and prognosis in acute lymphoblastic leukemia Genome-wide association study implicates a chromosome 12 risk locus for late-onset Alzheimer disease SIRT6 links histone H3 lysine 9 deacetylation to NF-kB-dependent gene expression and organismal life span An adenoviral vector-based mucosal vaccine is effective in protection against botulism Runx1 is required for the endothelial to haematopoietic cell transition but not thereafter Human calmodulin-like protein (CLP) expression in oral squamous mucosa and in malignant transformation Transcriptome sequencing to detect gene fusions in cancer AdPLA ablation increases lipolysis and prevents obesity induced by high-fat feeding or leptin deficiency COX2 in CNS neural cells mediates mechanical inflammatory pain hypersensitivity in mice Dissociation of seizure traits in inbred strains of mice using the flurothyl kindling model of epileptogenesis In vitro senescence of rat mesenchymal stem cells is accompanied by downregulation of stemness-related and DNA damage repair genes Drosophila stem cells share a common requirement for the histone H2B ubiquitin protease scrawny iPS cell generation using a single lentiviral stem cell cassette Neuronal activity–induced Gadd45b promotes epigenetic DNA demethylation and adult neurogenesis Isolation and characterization of pluripotent human spermatogonial stem cell-derived cells Advancing systems biology for medical applications The role of the biochemical and biophysical environment in chondrogenic stem cell differentiation assays and cartilage tissue engineering Hypoxia-induced lysyl oxidase is a critical mediator of bone marrow cell recruitment to form the premetastatic niche Development of a novel mouse glioma model using lentiviral vectors Carcinoma-produced factors activate myeloid cells through TLR2 to stimulate metastasis MTDH activation by 8q22 genomic gain promotes chemoresistance and metastasis of poor-prognosis breast cancer Ligand-independent androgen receptor variants derived from splicing of cryptic exons signify hormone-refractory prostate cancer Myocardial adeno-associated virus serotype 6–βARKct gene therapy improves cardiac function and normalizes the neurohormonal axis in chronic heart failure Microfluidic control of cell pairing and fusion Effects of cardiorespiratory fitness and cerebral blood flow on cognitive outcomes in older women Differential mobilization of subsets of progenitor cells from the bone marrow Ulcerative colitis–risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study The tumor suppressor gene ARHI regulates autophagy and tumor dormancy in human ovarian cancer cells Digoxin and other cardiac glycosides inhibit HIF-1α synthesis and block tumor growth Reversal of heroin neurobehavioral teratogenicity by grafting of neural progenitors Transplantation of neural progenitors enhances production of endogenous cells in the impaired brain The brain in the age of old: The hippocampal formation is targeted differentially by diseases of late life Comparative genome sequence analysis of multidrug-resistant Acinetobacter baumannii Development of a portable therapeutic and high intensity ultrasound system for military, medical, and research use Fate tracing reveals the endothelial origin of hematopoietic stem cells Label-free biomedical imaging with high sensitivity by stimulated Raman scattering microscopy Tissue-specific genetic control of splicing: implications for the study of complex traits Tumor vasculature-targeted delivery of tumor necrosis factor-a Clinical responses to gene therapy in joints of two subjects with rheumatoid arthritis Starving neurons show sex difference in autophagy Multiplex protein assays based on real-time magnetic nanotag sensing A postnatal switch of CELF and MBNL proteins reprograms alternative splicing in the developing heart Nodal signalling is involved in left–right asymmetry in snails Murine bone marrow-derived mesenchymal stem cells as vehicles for interleukin-12 gene delivery into Ewing sarcoma tumors Leukemic cells create bone marrow niches that disrupt the behavior of normal hematopoietic progenitor cells β-Catenin downregulation attenuates ischemic cardiac remodeling through enhanced resident precursor cell differentiation Genetic defects in surfactant protein a2 are associated with pulmonary fibrosis and lung cancer Dysregulation of lipid and amino acid metabolism precedes islet autoimmunity in children who later progress to type 1 diabetes In vitro analog of human bone marrow from 3D scaffolds with biomimetic inverted colloidal crystal geometry Cultural cognition of the risks and benefits of nanotechnology Shared and distinct genetic variants in type 1 diabetes and celiac disease Non-myeloablative hematopoietic stem cell transplantation in older patients with AML and MDS: Results from the Center for International Blood and Marrow Transplant Research (CIBMTR) Common variants at 30 loci contribute to polygenic dyslipidemia Subdivisions of primary motor cortex based on cortico-motoneuronal cells Prominin 1 marks intestinal stem cells that are susceptible to neoplastic transformation An obesity-associated FTO gene variant and increased energy intake in children Deregulation of HDAC1 by p25/Cdk5 in neurotoxicity Calcium phosphate nanocomposite particles for in vitro imaging and encapsulated chemotherapeutic drug delivery to cancer cells Multimodal optical sensing and analyte specificity using single-walled carbon nanotubes Hematopoietic stem cells reversibly switch from dormancy to self-renewal during homeostasis and repair Synergistic actions of hematopoietic and mesenchymal stem/progenitor cells in vascularizing bioengineered tissues Dynamic correlation between intrahost HIV-1 quasispecies evolution and disease progression Reprogramming of murine and human somatic cells using a single polycistronic vector AAV2/1-TNFR:Fc gene delivery prevents periodontal disease progression Optical methodology for detecting histologically unapparent nanoscale consequences of genetic alterations in biological cells Delivery of apoptotic signal to rolling cancer cells: A novel biomimetic technique using immobilized TRAIL and E-selectin Aberrant chromatin at genes encoding stem cell regulators in human mixed-lineage leukemia Endochondral ossification is required for haematopoietic stem-cell niche formation Self-renewal and expansion of single transplanted muscle stem cells Chromosome 15q25.1 genetic markers associated with level of response to alcohol in humans Evaluating the safety and efficacy of anti-HIV transgenic cells in a humanized mouse model (NOD/SCIDγc–/–) for HIV stem cell gene therapy Selective molecular imaging of viable cancer cells with pH-activatable fluorescence probes Membrane shape as a reporter for applied forces Detection of functional haematopoietic stem cell niche using real-time imaging Amelioration of epidermolysis bullosa by transfer of wild-type bone marrow cells Analysis of histone 2B-GFP retention reveals slowly cycling hematopoietic stem cells Non-cell-autonomous effect of human SOD1G37R astrocytes on motor neurons derived from human embryonic stem cells Hematopoietic stem cell function and survival depend on c-Myc and N-Myc activity Hematopoietic stem cells reversibly switch from dormancy to self-renewal during homeostasis and repair Sequential development of synapses in dendritic domains during adult neurogenesis Genomic analysis of the clonal origins of relapsed acute lymphoblastic leukemia Lytic granule loading of CD8+ T cells is required for HIV-infected cell elimination associated with immune control Fanconi anemia deficiency stimulates HPV-associated hyperplastic growth in organotypic epithelial raft culture Cutting edge: a T-bet-independent role for IFN-/β in regulating IL-2 secretion in human CD4+ central memory T cells Membrane potential controls adipogenic and osteogenic differentiation of mesenchymal stem cells Single-RNA counting reveals alternative modes of gene expression in yeast Blazing the trail from stem cell research to regenerative medicine Ascites specific inhibition of CD1d-mediated activation of natural killer T cells Deregulation of scribble promotes mammary tumorigenesis and reveals a role for cell polarity in carcinoma Notch pathway modulation on bone marrow-derived vascular precursor cells regulates their angiogenic and wound healing potential Efficient tumour formation by single human melanoma cells Identification of a receptor required for the anti-inflammatory activity of IVIG A dynamic zone defines interneuron remodeling in the adult neocortex α-Catenin mediates initial E-cadherin-dependent cell–cell recognition and subsequent bond strengthening A novel flex-stretch-flow bioreactor for the study of engineered heart valve tissue mechanobiology Mistranslation of membrane proteins and two-component system activation trigger antibiotic-mediated cell death Cyclic nucleotide phosphodiesterase profiling reveals increased expression of phosphodiesterase 7B in chronic lymphocytic leukemia Exercise enhances the proliferation of neural stem cells and neurite growth and survival of neuronal progenitor cells in dentate gyrus of middle-aged mice Stimulation of neural regeneration in the mouse retina A novel method for enrichment and selection of dopamine progenitor cells from human ES cells New ISSCR guidelines underscore major principles for responsible translational stem cell research Derivation of functional insulin-producing cell lines from primary mouse embryo culture Generating mESC-derived insulin-producing cell lines through an intermediate lineage-restricted progenitor line Association of genes involved in lipid metabolismperoxidation and risk of renal cancer in the Central European Renal Cancer Case-Control Study Convergent functional genomics of genome-wide association data for bipolar disorder: Comprehensive identification of candidate genes, pathways and mechanisms Transplanted mouse embryonic stem-cell-derived motoneurons form functional motor units and reduce muscle atrophy Targeting lactate-fueled respiration selectively kills hypoxic tumor cells in mice Generation of retinal stem cells and functional eyes from pluripotent cells Clinical transplantation of a tissue-engineered airway Control of HIV-1 immune escape by CD8 T cells expressing enhanced T-cell receptor Glioblastoma microvesicles transport RNA and proteins that promote tumour growth and provide diagnostic biomarkers Endogenous VEGF is required for visual function: evidence for a survival role on Müller cells and photoreceptors Stable long-term donor engraftment following reduced-intensity hematopoietic cell transplantation for sickle cell disease The forkhead protein Foxj1 specifies node-like cilia in Xenopus and zebrafish embryos Impaired ERAD and ER stress are early and specific events in polyglutamine toxicity PEA-15 induces autophagy in human ovarian cancer cells and is associated with prolonged overall survival Striatal dysregulation of Cdk5 alters locomotor responses to cocaine, motor learning, and dendritic morphology Cdk5 is essential for adult hippocampal neurogenesis The histone H3 lysine 27-specific demethylase Jmjd3 is required for neural commitment A missense variant (P10L) of the melanopsin (OPN4) gene in seasonal affective disorder Putative dental pulp-derived stem/stromal cells promote proliferation and differentiation of endogenous neural cells in the hippocampus of mice The common inhalation anesthetic isoflurane induces caspase activation and increases amyloid B-protein level in vivo Intravital imaging of metastatic behavior through a mammary imaging window H3K79 methylation profiles define murine and human MLL-AF4 leukemias A role for VEGF as a negative regulator of pericyte function and vessel maturation Electromagnetic interference (EMI) of implanted cardiac devices by MP3 player headphones Early treatment of high-risk chronic lymphocytic leukemia with alemtuzumab and rituximab Targeting ErbB2 and ErbB3 with a bispecific single-chain Fv enhances targeting selectivity and induces a therapeutic effect in vitro Myogenic endothelial cells purified from human skeletal muscle improve cardiac function after transplantation into infarcted myocardium Illumination controls differentiation of dopamine neurons regulating behavior Effects of direct transplantation of multipotent mesenchymal stromal/stem cells into the demyelinated spinal cord Foxl1 is a marker of bipotential hepatic progenitor cells in mice Mechanical and biological properties of nanoporous carbon membranes Harvesting the energy of cardiac motion to power a pacemaker Cleavage of the Wnt receptor Ryk regulates neuronal differentiation during cortical neurogenesis Human tissue-engineered heart valves based on umbilical cord blood derived progenitor cells as single cell source A role for VEGF as a negative regulator of pericyte function and vessel maturation Induction of pluripotent stem cells from mouse embryonic fibroblasts by Oct4 and Klf4 with small-molecule compounds CaMKII-mediated phosphorylation of the myosin motor Myo1c is required for insulin-stimulated GLUT4 translocation in adipocytes Structure of Seneca Valley Virus-001: an oncolytic picornavirus representing a new genus Wnt signaling mediates self-organization and axis formation in embryoid bodies A human natural killer cell subset provides an innate source of IL-22 for mucosal immunity Immune control of an SIV challenge by a T-cell-based vaccine in rhesus monkeys H2AZ is enriched at polycomb complex target genes in ES cells and is necessary for lineage commitment Cathepsin L proteolytically processes histone H3 during mouse embryonic stem cell differentiation 5|[prime]|-triphosphate-siRNA: turning gene silencing and Rig-I activation against melanoma Alternative isoform regulation in human tissue transcriptomes HITS-CLIP yields genome-wide insights into brain alternative RNA processing Androgen receptor functional analyses by high throughput imaging: determination of ligand, cell cycle, and mutation-specific effects Toll-like receptor–induced arginase 1 in macrophages thwarts effective immunity against intracellular pathogens Accordion-like honeycombs for tissue engineering of cardiac anisotropy The in vitro effects of bupivacaine on articular chondrocytes Arsenic-stimulated liver sinusoidal capillarization in mice requires NADPH oxidase–generated superoxide Sfrp5 coordinates foregut specification and morphogenesis by antagonizing both canonical and noncanonical Wnt11 signaling Chemical engineering of mesenchymal stem cells to induce a cell rolling response Nf1-dependent tumors require a microenvironment containing Nf1+/−- and c-kit-dependent bone marrow Hedgehog signaling regulates brain tumor initiating cell proliferation and portends shorter survival for patients with PTEN-coexpressing glioblastomas Genome-wide association analysis reveals putative Alzheimer's Disease susceptibility loci in addition to APOE Engineering microRNA responsiveness to decrease virus pathogenicity Diverse RNA-binding proteins interact with functionally related sets of RNAs, suggesting an extensive regulatory system A conserved arginine containing motif crucial for the assembly and enzymatic activity of the Mixed Lineage Leukemia protein-1 core complex A single intravenous injection of adeno-associated virus serotype-9 leads to whole body skeletal muscle transduction in dogs Role of kinin B2 receptor signaling in the recruitment of circulating progenitor cells with neovascularization potential Serum inter-a-trypsin inhibitor and matrix hyaluronan promote angiogenesis in fibrotic lung injury Glia are essential for sensory organ function in C. elegans Fault diagnosis engineering of digital circuits can identify vulnerable molecules in complex cellular pathways Gene expression profiles during in vivo human rhinovirus infection A fast, robust and tunable synthetic gene oscillator Hmga2 promotes neural stem cell self-renewal in young but not old mice by reducing p16Ink4a and p19Arf expression Compensatory growth of healthy cardiac cells in the presence of diseased cells restores tissue homeostasis during heart development Notch signaling regulates mammary stem cell function and luminal cell-fate commitment Generation of a prostate from a single adult stem cell Network model of survival signaling in large granular lymphocyte leukemia DNA double-strand breaks activate a multi-functional genetic program in developing lymphocytes Cross-talk between GlcNAcylation and phosphorylation: Site-specific phosphorylation dynamics in response to globally elevated O-GlcNAc Evolution of MDA-5/RIG-I-dependent innate immunity: Independent evolution by domain grafting Global reorganization of replication domains during embryonic stem cell differentiation Modulation of potassium channel function confers a hyperproliferative invasive phenotype on embryonic stem cells Specific microbiota direct the differentiation of IL-17-producing T-helper cells in the mucosa of the small intestine Efficient and rapid generation of induced pluripotent stem cells from human keratinocytes Restoration of visual function in retinal degeneration mice by ectopic expression of melanopsin Centrosome misorientation reduces stem cell division during ageing Lgr5 marks cycling, yet long-lived, hair follicle stem cells Hematopoietic stem cell transplantation in patients with sporadic amyotrophic lateral sclerosis Mitochondrial metabolism modulates differentiation and teratoma formation capacity in mouse embryonic stem cells Mobilized hematopoietic stem cell yield depends on species-specific circadian timing HSP90β regulates rapsyn turnover and subsequent AChR cluster formation and maintenance Ikaros confers early temporal competence to mouse retinal progenitor cells Association of three genetic loci with uric acid concentration and risk of gout: a genome-wide association study Hematopoietic stem cell quiescence is maintained by compound contributions of the retinoblastoma gene family ACF7 regulates cytoskeletal-focal adhesion dynamics and migration and has ATPase activity Nanoparticulate delivery of diphtheria toxin DNA effectively kills mesothelin expressing pancreatic cancer cells A role for macroautophagy in protection against 4-hydroxytamoxifen–induced cell death and the development of antiestrogen resistance Focal transplantation–based astrocyte replacement is neuroprotective in a model of motor neuron disease Higher-order cellular information processing with synthetic RNA devices In vivo cloning of artificial DNA nanostructures Ablation of CD11c-positive cells normalizes insulin sensitivity in obese insulin resistant animals Visualizing stromal cell dynamics in different tumor microenvironments by spinning disk confocal microscopy Spinal cord injury reveals multilineage differentiation of ependymal cells Distinct tumor suppressor mechanisms evolve in rodent species that differ in size and lifespan Planarian PTEN homologs regulate stem cells and regeneration through TOR signaling In vivo modeling and detection of the ovarian cancer vascular marker TEM1 Identification of white adipocyte progenitor cells in vivo Generation of pluripotent stem cells from adult human testis Repigmentation of vitiligo by transplantation of autologous melanocyte cells cultured on amniotic membrane TSG-6 regulates bone remodeling through inhibition of osteoblastogenesis and osteoclast activation Oligopotent stem cells are distributed throughout the mammalian ocular surface Glycogen synthase kinase 3 in MLL leukaemia maintenance and targeted therapy Generation of insulin-secreting islet-like clusters from human skin fibroblasts Tissue- and age-specific changes in gene expression during disease induction and progression in NOD mice Evidence that an early pregnancy causes a persistent decrease in the number of functional mammary epithelial stem cells—implications for pregnancy-induced protection against breast cancer Effective rescue of dystrophin improves cardiac function in dystrophin-deficient mice by a modified morpholino oligomer Targeted development of registries of biological parts Volumetric and ionic regulation during the in vitro development of a corneal endothelial barrier Ependymal stem cells divide asymmetrically and transfer progeny into the subventricular zone when activated by injury Quantitation of aurora kinase A gene copy number in urine sediments and bladder cancer detection Human gene therapy for RPE65 isomerase deficiency activates the retinoid cycle of vision but with slow rod kinetics Induced pluripotent stem cells generated without viral integration Small-molecule inhibitors of microRNA miR-21 function Preventing growth of brain tumors by creating a zone of resistance Noncytotoxic lytic granule–mediated CD8+ T cell inhibition of HSV-1 reactivation from neuronal latency. Calcification of multipotent prostate tumor endothelium Refractive index maps and membrane dynamics of human red blood cells parasitized by Plasmodium falciparum Regulatory networks define phenotypic classes of human stem cell lines ES-cell derived hematopoietic cells induce transplantation tolerance Reduction of myocardial infarct size by human mesenchymal stem cell conditioned medium Embryonic stem cell therapy of heart failure in genetic cardiomyopathy Isolation of a slowly adhering cell fraction containing stem cells from murine skeletal muscle by the preplate technique. Phase I trial of leber congenital amaurosis due to RPE65 mutations by ocular subretinal injection of adeno-associated virus gene vector: short-term results Regulatory networks define phenotypic classes of human stem cell lines In vivo gene delivery to proliferating cells in the striatum generated in response to a 6-hydroxydopamine lesion of the nigro-striatal dopamine pathway DYRK1A-dosage imbalance perturbs NRSF/REST Levels, Deregulating Pluripotency and Embryonic Stem Cell Fate in Down Syndrome The type I TGF-b receptor engages TRAF6 to activate TAK1 in a receptor kinase-independent manner Genes mirror geography within Europe Discovery of a hepatitis C target and its pharmacological inhibitors by microfluidic affinity analysis In vivo reprogramming of adult pancreatic exocrine cells to B-cells HES-1 is involved in adaptation of adult human β-cells to proliferation in vitro Synthesis and evaluation of synthetic retinoid derivatives as inducers of stem cell differentiation Integrins control the positioning and proliferation of follicle stem cells in the Drosophila ovary Senescence of activated stellate cells limits liver fibrosis Allogeneic endometrial regenerative cells: an "off the shelf solution" for critical limb ischemia? Immunosuppressive therapy mitigates immunological rejection of human embryonic stem cell xenografts Making insulin-deficient type 1 diabetic rodents thrive without insulin Biological properties and enucleation of red blood cells from human embryonic stem cells The rho-rock-myosin signaling axis determines cell-cell integrity of self-renewing pluripotent stem cells Interferon-α initiates type 1 diabetes in nonobese diabetic mice Posttraumatic stress and complicated grief in family members of patients in the intensive care unit. TH17 cells mediate steroid-resistant airway inflammation and airway hyperresponsiveness in mice A perivascular origin for mesenchymal stem cells in multiple human organs Transoral endoscopic fundoplication in the treatment of gastroesophageal reflux disease: the anatomic and physiologic basis for reconstruction of the esophagogastric junction using a novel device Functional auditory hair cells produced in the mammalian cochlea by in utero gene transfer Drug delivery with carbon nanotubes for in vivo cancer treatment Toll-like receptor 3 and geographic atrophy in age-related macular degeneration Carcinogen-altered genes in rat esophagus positively modulated to normal levels of expression by both black raspberries and phenylethyl isothiocyanate Increase in endoplasmic reticulum stress–related proteins and genes in adipose tissue of obese, insulin-resistant individuals Neuropilin-1 in regulation of VEGF-induced activation of p38MAPK and endothelial cell organization Expression of ACE (CD143) identifies and regulates primitive hemangioblasts derived from human pluripotent stem cells Systems biology of the clock in Neurospora crassa Racial differences in the frequencies of HLA-specific B cells The age lipid A2E and mitochondrial dysfunction synergistically impair phagocytosis by retinal pigment epithelial cells Mouse development with a single E2F activator A pilot study of consolidative immunotherapy in patients with high-risk pediatric sarcomas Ectodermal Smad4 and p38 MAPK are functionally redundant in mediating TGF-β/BMP signaling during tooth and palate development Gastrin-releasing peptide receptor silencing suppresses the tumorigenesis and metastatic potential of neuroblastoma Tumor regression in cancer patients by very low doses of a T cell–engaging antibody Pre-clinical evaluation of a novel nanoemulsion-based hepatitis B mucosal vaccine Inhibition of human glutaminyl cyclase: A potential new treatment for AD PRDM16 controls a brown fat/skeletal muscle switch Acquisition of granule neuron precursor identity is a critical determinant of progenitor cell competence to form shh-induced medulloblastoma GATA transcription factors directly regulate the Parkinson's disease-linked gene α-synuclein Bone marrow-derived mesenchymal stem cells ameliorate autoimmune enteropathy independently of regulatory T cells Association of a polymorphism near CREB1 with differential aversion processing in the insula of healthy participants Detecting skin cancer using volatile biomarkers Analyses of volatile organic compounds from human skin Primary cilia regulate hippocampal neurogenesis by mediating sonic hedgehog signaling A human embryonic stem cell line derived from a single blastomere of a 4-cell stage embryo Immobilized metal-affinity protein delivery via polyketal microparticles A new reactive oxygen species sensitive drug delivery vehicle for targeting oxidative stress Establishment of endoderm progenitors by SOX transcription factor expression in human embryonic stem cells Current and future considerations in the use of mechanical circulatory support devices Connecting microRNA genes to the core transcriptional regulatory circuitry of embryonic stem cells Dual origin of tissue-specific progenitor cells in Drosophila tracheal remodeling Senescence of activated stellate cells limits liver fibrosis Induced pluripotent stem cells generated from patients with ALS can be differentiated into motor neurons Collaborative genome-wide association analysis supports a role for ANK3 and CACNA1C in bipolar disorder Synthesis and antiproliferative activity of curcumin analogs Restoration of chaperone-mediated autophagy in aging liver improves cellular maintenance and hepatic function Phosphorylation of SNAP-23 by IκB kinase 2 regulates mast cell degranulation Ribosomal mutations cause p53-mediated dark skin and pleiotropic effects Genome-scale DNA methylation maps of pluripotent and differentiated cells Dissecting direct reprogramming through integrative genomic analysis Cellular origins of adult human islet in vitro dedifferentiation Engineering robust and functional vascular networks in vivo with human adult and cord blood–derived progenitor cells T cell-independent and toll-like receptor-dependent antigen-driven activation of autoreactive B cells T cell-specific siRNA delivery suppresses HIV-1 infection in humanized mice Experience-dependent transfer of Otx2 homeoprotein into the visual cortex activates postnatal plasticity Insertional oncogenesis in 4 patients after retrovirus-mediated gene therapy of SCID-X1 Germline mutations and variants in the succinate dehydrogenase genes in cowden and cowden-like syndromes Disease-specific induced pluripotent stem cells The effect of particle design on cellular internalization pathways A preliminary gene expression profile of acute graft-versus-host disease Induction of plasma (TRAIL), TNFR-2, Fas ligand, and plasma microparticles after human immunodeficiency virus type 1 (HIV-1) transmission: implications for HIV-1 vaccine design Gene expression patterns in visual cortex during the critical period: Synaptic stabilization and reversal by visual deprivation Role of Sox-9, ER81 and VE-Cadherin in retinoic acid-mediated trans-differentiation of breast cancer cells Adaptive Foxp3+ regulatory t cell-dependent and -independent control of allergic inflammation A precisely regulated gene expression cassette potently modulates metastasis and survival in multiple solid cancers Induction of immunological tolerance by apoptotic cells requires caspase-dependent oxidation of high-mobility group box-1 protein Bioresorbable hyaluronic acid hydrogels for tissue engineering applications Catalytic antibodies to HIV: Physiological role and potential clinical utility Calcium control of endocytic capacity at a CNS synapse Duffy antigen receptor for chemokines mediates trans-infection of HIV-1 from red blood cells to target cells and affects HIV-AIDS susceptibility Convergence of mutation and epigenetic alterations identifies common genes in cancer that predict for poor prognosis Highly efficient, functional engraftment of skeletal muscle stem cells in dystrophic muscles Miniaturized probe for femtosecond laser microsurgery and two-photon imaging An RNAi screen of chromatin proteins identifies Tip60-p400 as a regulator of embryonic stem cell identity Young age at diagnosis correlates with worse prognosis and defines a subset of breast cancers with shared patterns of gene expression Antisense transcripts are targets for activating small RNAs Statin treatment of adult human glial progenitors induces PPARΎ-mediated oligodendrocytic differentiation Multiphoton fabrication of chemically responsive protein hydrogels for microactuation Large-scale analysis of gene clustering in bacteria Mesp1 coordinately regulates cardiovascular fate restriction and epithelial-mesenchymal transition in differentiating escs A drug-inducible transgenic system for direct reprogramming of multiple somatic cell types Genomic and proteomic analysis reveals a threshold level of MYC required for tumor maintenance Olfactory mucosa is a potential source for autologous stem cell therapy for Parkinson's Disease PANIC–ATTAC, a mouse model for inducible and reversible β cell ablation Epicardial progenitors contribute to the cardiomyocyte lineage in the developing heart Treatment of metastatic melanoma with autologous CD4+ T cells against NY-ESO-1 Targeting mutant p53 protein and tumor vasculature: An effective combination therapy for advanced breast tumors A Gata6-Wnt pathway required for epithelial stem cell development and airway regeneration GHRH improves survival and quality of life of companion dogs with cancer Protein−protein interaction detection in vitro and in cells by proximity biotinylation DNA packaging via combinative self-assembly Myocyte enhancer factor 2C as a neurogenic and antiapoptotic transcription factor in murine embryonic stem cells The B cell antigen receptor and overexpression of MYC can cooperate in the genesis of B cell lymphomas Intra-abdominal vagal blocking (VBLOC therapy): Clinical results with a new implantable medical device Dunking doughnuts into cells—selective cellular translocation and in vivo analysis of polymeric micro-doughnuts IRF4 addiction in multiple myeloma Polygenes, risk prediction, and targeted prevention of breast cancer Neonatal chimerization with human glial progenitor cells can both remyelinate and rescue the otherwise lethally hypomyelinated shiverer mouse IL1RL1-IL18R1-IL18RAP-SLC9A4 and CARD9 loci are susceptibility factors for both Crohn’s disease and ulcerative colitis Synergistic and additive effects of hydrostatic pressure and growth factors on tissue formation Enhanced chondrocyte densities on carbon nanotube composites: The combined role of nanosurface roughness and electrical stimulation Evaluating suppression of nonsense mutations by aminoglycoside antibiotics as an intervention for vision loss in type I Usher syndrome Treatment of Late Infantile Neuronal Ceroid Lipofuscinosis by CNS administration of a serotype 2 adeno-associated virus expressing CLN2 cDNA Blocking TGF-–Smad2/3 innate immune signaling mitigates Alzheimer-like pathology Conditional mouse osteosarcoma, dependent on p53 loss and potentiated by loss of Rb, mimics the human disease Imbalance between pSmad3 and Notch induces CDK inhibitors in old muscle stem cells In vivo biocompatibility of ultra-short single-walled carbon nanotube/biodegradable polymer nanocomposites for bone tissue engineering Fatty acid synthase is upregulated during HCV infection and regulates HCV entry and production Ephrins as negative regulators of adult neurogenesis in diverse regions of the central nervous system Bmi1 is expressed in vivo in intestinal stem cells Shear stress improves adult stem cell attachment to vascular basement membrane components via upregulation of α5ß1integrin expression Inhalable siRNA: potential as a therapeutic agent in the lungs Cooperation of two MRNA-binding proteins drives metabolic adaptation to iron deficiency Cortical control of a prosthetic arm for self-feeding The ground state of embryonic stem cell self-renewal Gene expression profiling of human prostate cancer stem cells reveals a pro-inflammatory phenotype and the importance of extracellular matrix interactions Toward a cure for type 1 diabetes mellitus: diabetes-suppressive dendritic cells and beyond Small-molecule activation of neuronal cell fate Neurons born in the adult dentate gyrus form functional synapses with target cells Defining the incidence of cardiorespiratory instability in patients in step-down units using an electronic integrated monitoring system Regional anatomic and age effects on cell function of human adipose-derived stem cells Increased plasma interleukin-6 in donors is associated with lower recipient hospital-free survival after cadaveric organ transplantation Improved efficiency and pace of generating induced pluripotent stem cells from human adult and fetal fibroblasts CD133 expression is not restricted to stem cells, and both CD133+ and CD133– metastatic colon cancer cells initiate tumors Pilot study of granulocyte colony stimulating factor (G-CSF)-mobilized peripheral blood stem cells in amyotrophic lateral sclerosis (ALS) cAMP/PKA pathway activation in human mesenchymal stem cells in vitro results in robust bone formation in vivo Establishment of mouse embryonic stem cell-derived erythroid progenitor cell lines able to produce functional red blood cells Multi-genetic events collaboratively contribute to Pten-null leukaemia stem-cell formation Osteolineage niche cells initiate hematopoietic stem cell mobilization Absorbent microbicidal wound dressing material with protease inhibition properties Functional genomic screen reveals genes involved in lipid-droplet formation and utilization Microparticle-mediated delivery of morphogenic factors within embryoid bodies Lysine-derived urethane surgical adhesive prevents seroma formation in a canine abdominoplasty model Repair of iatrogenic sphincter damage and urinary incontinence by autologous skeletal muscle derived cells (mdc) Transurethral ultrasound guided injection of autologus myo- and fibroblasts in incontinent men: 2 year data Bergmann glia and the recognition molecule CHL1 organize GABAergic axons and direct innervation of Purkinje cell dendrites Next generation of adeno-associated virus 2 vectors: point mutations in tyrosines lead to high-efficiency transduction at lower doses Oral IL-10 gene delivery in a microsphere-based formulation for local transfection and therapeutic efficacy in inflammatory bowel disease Ex vivo expansion of cord blood nk cells with in vivo efficacy against acute myeloblastic and lymphoblastic leukemias The epithelial-mesenchymal transition generates cells with properties of stem cells Label-retaining cells of the bladder: candidate urothelial stem cells Latent stem and progenitor cells in the hippocampus are activated by neural excitation Endochondral bone tissue engineering using embryonic stem cells Expression of an estrogen receptor agonist in differentiating osteoblast cultures Dendritic cells in islets of Langerhans constitutively present β cell-derived peptides bound to their class II MHC molecules Genetic approaches identify adult pituitary stem cells Safety and efficacy of gene transfer for Leber's Congenital Amaurosis Multiple genetic loci for bone mineral density and fractures Extensive fusion of haematopoietic cells with Purkinje neurons in response to chronic inflammation Fibronectin bridges monocytes and reticulocytes via integrin α4β1 Efficacy and safety of renal tubule cell therapy for acute renal failure Bone marrow-derived circulating endothelial precursors do not contribute to vascular endothelium and are not needed for tumor growth Intercellular transfer of the oncogenic receptor EGFRvIII by microvesicles derived from tumour cells A novel magnetic approach to enhance the efficacy of cell-based gene therapies Direct reprogramming of terminally differentiated mature B lymphocytes to pluripotency Identification and characterization of cancer stem cells in ovarian cancer In vivo immunogold labeling confirms large-scale chromatin folding motifs Akt requires glucose-mediated regulation of bcl-2 family members to inhibit cell death Local delivery of gene vectors from bare-metal stents by use of a biodegradable synthetic complex inhibits in-stent restenosis in rat carotid arteries Serotype-dependent packaging of large genes in adeno-associated viral vectors results in effective gene delivery in mice A microsphere-based vaccine prevents and reverses new-onset autoimmune diabetes Translational systems biology of inflammation A novel flex-stretch-flow bioreactor for the study of engineered heart valve tissue mechanobiology HDAC4 and PCAF bind to cardiac carcomeres and play a role in regulating myofilament contractile activity Minute dosages of aVB3-targeted fumagillin nanoparticles impair Vx-2 tumor angiogenesis and development in rabbits Musashi1 regulates mammary progenitor cell expansion through activation of the Wnt and Notch pathway Endothelins are vascular-derived axonal guidance cues for developing sympathetic neurons Cardiogenic small molecules that enhance myocardial repair by stem cells Lifetime probabilities of hematopoietic stem cell transplantation in the U.S. Nucleofection mediates high-efficiency stable gene knockdown and transgene expression in human embryonic stem cells Noninvasive delivery of gene targeting probes to live brains for transcription MRI Memory enhancement induced by hypothalamic/fornix deep brain stimulation Light-activated channels targeted to ON bipolar cells restore visual function in retinal degeneration A combinatorial library of lipid-like materials for delivery of RNAi therapeutics Arthroscopic replacement of massive, irreparable rotator cuff tears using a graftjacket allograft: technique and preliminary results Targeted gene knockout in mammalian cells by using engineered zinc-finger nucleases Nanofibrous scaffolds incorporating PDGF-BB microspheres induce chemokine expression and tissue neogenesis in vivo Origin and progeny of reactive gliosis: a source of multipotent cells in the injured brain Harvested human neurons engineered as live nervous tissue constructs: implications for transplantation AAV vector-mediated reversal of hypoglycemia in canine and murine glycogen storage disease type Ia The emergence of hematopoietic stem cells is initiated in the placental vasculature in the absence of circulation Contractile smooth muscle cells derived from hair-follicle stem cells PAX4 enhances beta-cell differentiation of human embryonic stem cells Cavity-enhanced optical frequency comb spectroscopy: application to human breath analysis Delayed rectifier and A-type potassium channels associated with Kv 2.1 and Kv 4.3 expression in embryonic rat neural progenitor cells Sequence- and target-independent angiogenesis suppression by siRNA via TLR3 Long-term enhancement of skeletal muscle mass and strength by single gene administration of myostatin inhibitors Neuroepithelial stem cell proliferation requires LIS1 for precise spindle orientation and symmetric division Peripheral injection of human umbilical cord blood stimulates neurogenesis in the aged rat brain An extended transcriptional network for pluripotency of embryonic stem cells Stem cells from human fat as cellular delivery vehicles in an athymic rat posterolateral spine fusion model In vivo correction of a Menkes disease model using antisense oligonucleotides Peripherally administered human umbilical cord blood cells reduce parenchymal and vascular B-amyloid deposit in Alzheimer mice Flt3L in combination with HSV1-TK-mediated gene therapy reverses brain tumor-induced behavioral deficits A comprehensive platform for ex vivo t-cell expansion based on biodegradable polymeric artificial antigen-presenting cells Antisera induced by infusions of autologous Ad-CD154-leukemia B cells identify ROR1 as an oncofetal antigen and receptor for Wnt5a Systemic vesicular stomatitis virus selectively destroys multifocal glioma and metastatic carcinoma in brain Evidence for the involvement of miRNA in redox regulated angiogenic response of human microvascular endothelial cells Lamin A-dependent misregulation of adult stem cells associated with accelerated ageing The molecular etiology of breast cancer: evidence from biomarkers of risk A new arena virus in a cluster of fatal transplant-associated diseases Nonmuscle myosin heavy chain IIA mediates integrin LFA-1 de-adhesion during T lymphocyte migration Rapid appearance and local toxicity of amyloid-B plaques in a mouse model of Alzheimer's disease Loss of singleminded-2s in the mouse mammary gland induces an epithelial-mesenchymal transition associated with up-regulation of slug and matrix metalloprotease 2 Transparent adult zebrafish as a tool for in vivo transplantation analysis Lentiviral delivered VRX496 long antisense sequences exerts molecular pressure on HIV-1 in human subjects Clinical applications of blood-derived and marrow-derived stem cells for nonmalignant diseases Hematopoiesis and immunity of HOXB4-transduced embryonic stem cell–derived hematopoietic progenitor cells Self-assembly of large and small molecules into hierarchically ordered sacs and membranes Independent evolution of an antiviral TRIMCyp in rhesus macaques Stimuli-responsive polymer nanocomposites inspired by the sea cucumber dermis Adherent self-renewable human embryonic stem cell-derived neural stem cell line: functional engraftment in experimental stroke model Transplanted endothelial cells repopulate the liver endothelium and correct the phenotype of hemophilia A mice The transition from stiff to compliant materials in squid beaks ALS-causing SOD1 mutants generate vascular changes prior to motor neuron degeneration Autologous transplantation of endothelial progenitor cells attenuates acute lung injury in rabbits Intrauterine transplantation of human fetal mesenchymal stem cells from first-trimester blood repairs bone and reduces fractures in osteogenesis imperfecta mice Sensory neuron targeting by self-complementary AAV8 via lumbar puncture for chronic pain Conserved GU-rich elements mediate mRNA decay by binding to CUG-binding protein 1 Gene expression changes in children with autism Hypothesis-based RNAi screening identifies neuroprotective genes in a Parkinson's disease model Submicroscopic duplications of the hydroxysteroid dehydrogenase HSD17B10 and the E3 ubiquitin ligase HUWE1 are associated with mental retardation DNA double helices recognize mutual sequence homology in a protein free environment NFATc1 balances quiescence and proliferation of skin stem cells P-selectin–coated microtube for enrichment of CD34+ hematopoietic stem and progenitor cells from human bone marrow Investigating the feasibility of stem cell enrichment mediated by immobilized selectins Capture and enrichment of CD34-positive haematopoietic stem and progenitor cells from blood circulation using P-selectin in an implantable device Human embryonic stem cell derivation from poor-quality embryos Generation of biologically contained Ebola viruses Characterization of transplanted green fluorescent protein+ bone marrow cells into adipose tissue Initiating and cancer-propagating cells in TEL-AML1-associated childhood leukemia Identification of cells initiating human melanomas Genome-wide association scan in women with systemic lupus erythematosus identifies susceptibility variants in ITGAM, PXK, KIAA1542 and other loci Molecular mechanisms linking wound inflammation and fibrosis: knockdown of osteopontin leads to rapid repair and reduced scarring Functional skeletal muscle regeneration from differentiating embryonic stem cells Nanomagnetic actuation of receptor-mediated signal transduction Ventilation strategy using low tidal volumes, recruitment maneuvers, and high positive end-expiratory pressure for acute lung injury and acute respiratory distress syndrome Positive end-expiratory pressure setting in adults with acute lung injury and acute respiratory distress syndrome Testing protocols in the intensive care unit--complex trials of complex interventions for complex patients Ex vivo glycan engineering of CD44 programs human multipotent mesenchymal stromal cell trafficking to bone A comparison of bare-metal and drug-eluting stents for off-label indications Cancer stem cells with genetic instability: the best vehicle with the best engine for cancer Genome-wide transcriptional analysis of the human cell cycle identifies genes differentially regulated in normal and cancer cells Epigenetic-mediated dysfunction of the bone morphogenetic protein pathway inhibits differentiation of glioblastoma-initiating cells High field gradient targeting of magnetic nanoparticle-loaded endothelial cells to the surfaces of steel stents Interleukin-6 is an essential regulator of satellite cell-mediated skeletal muscle hypertrophy Freeze-dried tendon allografts as tissue-engineering scaffolds for Gdf5 gene delivery Recurrent 16p11.2 microdeletions in autism Expression of indoleamine 2,3-dioxygenase in metastatic pancreatic ductal adenocarcinoma recruits regulatory t cells to avoid immune detection Review of U.S. medical device regulation The use of keratin biomaterials derived from human hair for the promotion of rapid regeneration of peripheral nerves Human embryonic stem cell lines generated without embryo destruction Perfusion-decellularized matrix: using nature's platform to engineer a bioartificial heart Early intramedullary femoral fixation versus external fixation in polytrauma patients at risk for systemic complications: a prospective randomized controlled multicenter study Rescue of pituitary function in a mouse model of isolated growth hormone deficiency type II by RNAi Recovery of supraspinal control of stepping via indirect propriospinal relay connections after spinal cord injury The potential of umbilical cord blood multipotent stem cells for nonhematopoietic tissue and cell regeneration Gene therapy reduces ethanol intake in an animal model of alcohol dependence Acute exposure to a moderate strength magnetic field reduces edema formation in rats Correction of Fragile X syndrome in mice Evaluation of promoter hypermethylation detection in body fluids as a screening/diagnosis tool for head and neck squamous cell carcinoma Effect of chemistry on thermo-mechanical shape-memory properties of acrylate networks Designing shape memory polymers networks for biomedical applications Atomistic characterization of the elastic bending behavior of metallic nanowires Modulating neuronal responses by controlled integration of acetylcholine-like functionalities in biomimetic polymers Reprogramming of human somatic cells to pluripotency with defined factors Imaging of mesenchymal stem cell transplant by bioluminescence and PET Three-dimensional cellular microarray for high-throughput toxicology assays HLA homozygous stem cell lines derived from human parthenogenetic blastocysts Unique dielectric properties distinguish stem cells and their differentiated progeny Improved cell survival in infarcted myocardium using a novel combination transmyocardial laser and cell delivery system Development of a tissue-engineered vascular graft combining a biodegradable scaffold, muscle-derived stem cells and a rotational vacuum seeding technique Isolation of rare circulating tumour cells in cancer patients by microchip technology Stem cell augmented reconstruction: a new hope for reconstruction after breast conservation therapy Identification of small molecules from human embryonic stem cells using metabolomics Comparable outcomes after nonmyeloablative hematopoietic cell transplantation with unrelated and related donors Safety of MGMT gene transfer into hematopoietic progenitors: a phase I clinical trial using retroviral gene transfer of G156A MGMT to protect hematopoiesis during BG plus alkylating agent treatment of advanced malignancies Restoration of human dystrophin following transplantation of exon-skipping-engineered DMD patient stem cells into dystrophic mice Identification of a hierarchy of multipotent hematopoietic progenitors in human cord blood Treatment of sickle cell anemia mouse model with iPS cells generated from autologous skin Scaffolds based on degradable alginate hydrogels and poly(lactide-co-glycolide) microspheres for stem cell culture Immunosurveillance by hematopoietic progenitor cells trafficking through blood, lymph, and peripheral tissues Mutation in glycerol-3-phosphate dehydrogenase 1–like gene (gpd1-l) decreases cardiac NA+ current and causes inherited arrhythmias Choosing among living-donor and cadaveric livers Endometrial regenerative cells: a novel stem cell population Evidence for skeletal progenitor cells in the degenerate human intervertebral disc Neural stem cells improve memory in an inducible mouse model of neuronal loss Rotary suspension culture enhances the efficiency, yield, and homogeneity of embryoid body differentiation Skin-derived precursors generate myelinating schwann cells that promote remyelination and functional recovery after contusion spinal cord injury Agent-based model of inflammation and wound healing: insights into diabetic foot ulcer pathology and the role of transforming growth factor-b1 Prospective identification of myogenic endothelial cells in human skeletal muscle A novel multiparametric flow cytometry-based cytotoxicity assay simultaneously immunophenotypes effector cells: Comparisons to a 4 h (51)Cr-release assay Long-term propagation of distinct hematopoietic differentiation programs in vivo Research criteria for the diagnosis of Alzheimer's disease: revising the NINCDS–ADRDA criteria Examination of the therapeutic potential of Delta-24-RGD in brain tumor stem cells: role of autophagic cell death Carbon nanotube sensors for exhaled breath components Transformation of different human breast epithelial cell types leads to distinct tumor phenotypes Understanding the inflammatory cytokine response in pneumonia and sepsis Common molecular signature in SOD1 for both sporadic and familial amyotrophic lateral sclerosis An elastic, biodegradable cardiac patch induces contractile smooth muscle and improves cardiac remodeling and function in subacute myocardial infarction Directed engineering of umbilical cord blood stem cells to produce C-peptide and insulin Amelioration of pain and histopathologic joint abnormalities in the Col1-IL-1βXAT mouse model of arthritis by intraarticular induction of μ-opioid receptor into the temporomandibular joint The healing effects of autologous platelet gel on acute human skin wounds Recovery from major depression in older adults receiving augmentation of antidepressant pharmacotherapy Developmental reprogramming after chromosome transfer into mitotic mouse zygotes Directly reprogrammed fibroblasts show global epigenetic remodeling and widespread tissue contribution Platelet-derived growth factor receptor-α: a novel therapeutic target in human hepatocellular cancer From Baghdad to Germany: use of a new pumpless extracorporeal lung assist system in two severely injured us soldiers Cyanidin-3-rutinoside, a natural polyphenol antioxidant, selectively kills leukemic cells by induction of oxidative stress A role for cell sex in stem cell–mediated skeletal muscle regeneration: female cells have higher muscle regeneration efficiency Environmentally sensitive gels assembled through protein-polysaccharide interactions Carbon monoxide protects against hyperoxia-induced endothelial cell apoptosis by inhibiting reactive oxygen species formation Stem and progenitor cells in skeletal muscle development, maintenance, and therapy Fiber kinematics of small intestinal submucosa under biaxial and uniaxial stretch Strategies for reducing the door-to-balloon time in acute myocardial infarction Design and analysis of tissue engineering scaffolds that mimic soft tissue mechanical anisotropy Craniofacial tissue engineering by stem cells Cartilage repair using bone morphogenetic protein 4 and muscle-derived stem cells Microintegrating smooth muscle cells into a biodegradable, elastomeric fiber matrix Differentiated cells are more efficient than adult stem cells for cloning by somatic cell nuclear transfer In situ labeling of immune cells with iron oxide particles: An approach to detect organ rejection by cellular MRI Proteomic profiling of cerebrospinal fluid identifies biomarkers for amyotrophic lateral sclerosis Differential myocardial infarct repair with muscle stem cells compared to myoblasts Surgical treatment for congestive heart failure with autologous adult stem cell transplantation: A prospective randomized study Mouse fetal liver cells in artificial capillary beds in three-dimensional four-compartment bioreactors Tissue-engineered myocardial patch derived from extracellular matrix provides regional mechanical function The vascular wall as a source of stem cells Outcomes 18 months after the first human partial face transplantation Autologous nonmyeloablative hematopoietic stem cell transplantation in newly diagnosed type 1 diabetes mellitus Towards improved artificial lungs through biocatalysis Integrating bench to operating room: journey of a clinician-scientist Wnt5a-treated midbrain neural stem cells improve dopamine cell replacement therapy in Parkinsonian mice Tissue-engineered autologous bladders for patients needing cystoplasty Nerve regeneration promoted in a tube with vascularity containing bone marrow-derived cells